HOOK2 (hook microtubule tethering protein 2)

Gene

• Entrez ID: 29911
• Gene name: Hook microtubule tethering protein 2
• Gene symbol: HOOK2
• Synonyms (NCBI Gene): HK2
• Chromosome: 19
• Chromosome location: 19p13.13
• Summary: Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocyt

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1052734	hsa-miR-1293	CLIP-seq
MIRT1052735	hsa-miR-4483	CLIP-seq
MIRT1052736	hsa-miR-4786-3p	CLIP-seq
MIRT1052737	hsa-miR-671-5p	CLIP-seq
MIRT2011986	hsa-miR-1200	CLIP-seq
MIRT2011987	hsa-miR-1827	CLIP-seq
MIRT2011988	hsa-miR-1976	CLIP-seq
MIRT2011989	hsa-miR-4324	CLIP-seq
MIRT2011990	hsa-miR-4649-3p	CLIP-seq
MIRT2011991	hsa-miR-544b	CLIP-seq
MIRT2244258	hsa-miR-4668-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 17140400, 18799622, 19273536, 21516116, 23414517, 24722188, 25416956, 26871637, 31515488, 31980649, 32073997, 32296183, 33961781, 34882091
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	32073997
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	17140400
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006897	Process	Endocytosis	TAS	9927460
GO:0007032	Process	Endosome organization	IEA
GO:0007032	Process	Endosome organization	IMP	18799622
GO:0007040	Process	Lysosome organization	IEA
GO:0007040	Process	Lysosome organization	IMP	18799622
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008333	Process	Endosome to lysosome transport	IEA
GO:0008333	Process	Endosome to lysosome transport	IMP	18799622
GO:0015031	Process	Protein transport	IEA
GO:0030705	Process	Cytoskeleton-dependent intracellular transport	IBA
GO:0030705	Process	Cytoskeleton-dependent intracellular transport	IEA
GO:0030897	Component	HOPS complex	IDA	18799622
GO:0031122	Process	Cytoplasmic microtubule organization	IBA
GO:0031122	Process	Cytoplasmic microtubule organization	IEA
GO:0042802	Function	Identical protein binding	IPI	18799622
GO:0045022	Process	Early endosome to late endosome transport	IEA
GO:0045022	Process	Early endosome to late endosome transport	IMP	18799622
GO:0051959	Function	Dynein light intermediate chain binding	IBA
GO:0070695	Component	FHF complex	IDA	18799622, 32073997
GO:0070695	Component	FHF complex	IEA
GO:1905719	Process	Protein localization to perinuclear region of cytoplasm	IEA
GO:1905719	Process	Protein localization to perinuclear region of cytoplasm	IMP	32073997

Other IDs

• MIM: 607824
• HGNC: 19885
• e!Ensembl: ENSG00000095066

Protein

• UniProt ID: Q96ED9
• Protein name: Protein Hook homolog 2 (h-hook2) (hHK2)
• Protein function: Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). Contributes to the establishment and maintena
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF19047	HOOK_N	7 → 157	HOOK domain	Domain
  PF05622	HOOK	179 → 705	HOOK protein coiled-coil region	Coiled-coil

• Sequence:

  MSVDKAELCGSLLTWLQTFHVPSPCASPQDLSSGLAVAYVLNQIDPSWFNEAWLQGISED
  PGPNWKLKVSNLKMVLRSLVEYSQDVLAHPVSEEHLPDVSLIGEFSDPAELGKLLQLVLG
  CAISCEKKQDHIQRIMTLEESVQHVVMEAIQELMTKDTPDSLSPETYGNFDSQSRRYYFL
  SEEAEEGDELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKKLLL
  LQSQLEQLQEENFRLESGREDERLRCAELEREVAELQHRNQALTSLAQEAQALKDEMDEL
  RQSSERAGQLEATLTSCRRRLGELRELRRQVRQLEERNAGHAERTRQLEDELRRAGSLRA
  QLEAQRRQVQELQGQRQEEAMKAEKWLFECRNLEEKYESVTKEKERLLAERDSLREANEE
  LRCAQLQPRGLTQADPSLDPTSTPVDNLAAEILPAELRETLLRLQLENKRLCRQEAADRE
  RQEELQRHLEDANRARHGLETQHRLNQQQLSELRAQVEDLQKALQEQGGKTEDAISILLK
  RKLEEHLQKLHEADLELQRKREYIEELEPPTDSSTARRIEELQHNLQKKDADLRAMEERY
  RRYVDKARMVMQTMEPKQRPAAGAPPELHSLRTQLRERDVRIRHLEMDFEKSRSQREQEE
  KLLISAWYNMGMALQQRAGEERAPAHAQSFLAQQRLATNSRRGPLGRLASLNLRPTDKH

• Sequence length: 719

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Scoliosis, isolated, susceptibility to, 1	Conflicting classifications of pathogenicity	rs897804	RCV006252573

Associations from Text Mining
Disease Name	Relationship Type	References
Diabetes Mellitus	Associate	32075680
Diabetes Mellitus Type 2	Associate	29228058
Metabolic Diseases	Associate	30782033
Obesity	Associate	29228058