Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29911
Gene name Gene Name - the full gene name approved by the HGNC.	Hook microtubule tethering protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HOOK2
Synonyms (NCBI Gene) Gene synonyms aliases	HK2
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.13
Summary Summary of gene provided in NCBI Entrez Gene.	Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocyt

Show/Hide all(11)

miRTarBase ID	miRNA	Experiments
MIRT1052734	hsa-miR-1293	CLIP-seq
MIRT1052735	hsa-miR-4483	CLIP-seq
MIRT1052736	hsa-miR-4786-3p	CLIP-seq
MIRT1052737	hsa-miR-671-5p	CLIP-seq
MIRT2011986	hsa-miR-1200	CLIP-seq
MIRT2011987	hsa-miR-1827	CLIP-seq
MIRT2011988	hsa-miR-1976	CLIP-seq
MIRT2011989	hsa-miR-4324	CLIP-seq
MIRT2011990	hsa-miR-4649-3p	CLIP-seq
MIRT2011991	hsa-miR-544b	CLIP-seq
MIRT2244258	hsa-miR-4668-3p	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 17140400, 18799622, 19273536, 21516116, 23414517, 24722188, 25416956, 26871637, 31515488, 31980649, 32073997, 32296183, 33961781, 34882091
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	32073997
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	17140400
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006897	Process	Endocytosis	TAS	9927460
GO:0007032	Process	Endosome organization	IEA
GO:0007032	Process	Endosome organization	IMP	18799622
GO:0007040	Process	Lysosome organization	IEA
GO:0007040	Process	Lysosome organization	IMP	18799622
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008333	Process	Endosome to lysosome transport	IEA
GO:0008333	Process	Endosome to lysosome transport	IMP	18799622
GO:0015031	Process	Protein transport	IEA
GO:0030705	Process	Cytoskeleton-dependent intracellular transport	IBA
GO:0030705	Process	Cytoskeleton-dependent intracellular transport	IEA
GO:0030897	Component	HOPS complex	IDA	18799622
GO:0031122	Process	Cytoplasmic microtubule organization	IBA
GO:0031122	Process	Cytoplasmic microtubule organization	IEA
GO:0042802	Function	Identical protein binding	IPI	18799622
GO:0045022	Process	Early endosome to late endosome transport	IEA
GO:0045022	Process	Early endosome to late endosome transport	IMP	18799622
GO:0051959	Function	Dynein light intermediate chain binding	IBA
GO:0070695	Component	FHF complex	IDA	18799622, 32073997
GO:0070695	Component	FHF complex	IEA
GO:1905719	Process	Protein localization to perinuclear region of cytoplasm	IEA
GO:1905719	Process	Protein localization to perinuclear region of cytoplasm	IMP	32073997

MIM	HGNC	e!Ensembl
607824	19885	ENSG00000095066

Protein

UniProt ID

Q96ED9

Protein name

Protein Hook homolog 2 (h-hook2) (hHK2)

Protein function

Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). Contributes to the establishment and maintena

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF19047	HOOK_N	7 → 157	HOOK domain	Domain
PF05622	HOOK	179 → 705	HOOK protein coiled-coil region	Coiled-coil

Sequence

MSVDKAELCGSLLTWLQTFHVPSPCASPQDLSSGLAVAYVLNQIDPSWFNEAWLQGISED
PGPNWKLKVSNLKMVLRSLVEYSQDVLAHPVSEEHLPDVSLIGEFSDPAELGKLLQLVLG
CAISCEKKQDHIQRIMTLEESVQHVVMEAIQELMTKDTPDSLSPETYGNFDSQSRRYYFL
SEEAEEGDELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKKLLL
LQSQLEQLQEENFRLESGREDERLRCAELEREVAELQHRNQALTSLAQEAQALKDEMDEL
RQSSERAGQLEATLTSCRRRLGELRELRRQVRQLEERNAGHAERTRQLEDELRRAGSLRA
QLEAQRRQVQELQGQRQEEAMKAEKWLFECRNLEEKYESVTKEKERLLAERDSLREANEE
LRCAQLQPRGLTQADPSLDPTSTPVDNLAAEILPAELRETLLRLQLENKRLCRQEAADRE
RQEELQRHLEDANRARHGLETQHRLNQQQLSELRAQVEDLQKALQEQGGKTEDAISILLK
RKLEEHLQKLHEADLELQRKREYIEELEPPTDSSTARRIEELQHNLQKKDADLRAMEERY
RRYVDKARMVMQTMEPKQRPAAGAPPELHSLRTQLRERDVRIRHLEMDFEKSRSQREQEE
KLLISAWYNMGMALQQRAGEERAPAHAQSFLAQQRLATNSRRGPLGRLASLNLRPTDKH

Sequence length

719

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Diabetes Mellitus	Associate	32075680
Diabetes Mellitus Type 2	Associate	29228058
Metabolic Diseases	Associate	30782033
Obesity	Associate	29228058

HOOK2 (hook microtubule tethering protein 2)