Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29906
Gene name	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5
Gene symbol	ST8SIA5
Synonyms (NCBI Gene)	SIAT8-ESIAT8EST8SiaV
Chromosome	18
Chromosome location	18q21.1
Summary	The protein encoded by this gene is a type II membrane protein that may be present in the Golgi apparatus. The encoded protein, which is a member of glycosyltransferase family 29, may be involved in the synthesis of gangliosides GD1c, GT1a, GQ1b, and GT3

Show/Hide all (51)

miRTarBase ID	miRNA	Experiments	Reference
MIRT450101	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT450102	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT450100	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT450099	hsa-miR-595	PAR-CLIP	22100165
MIRT450098	hsa-miR-3163	PAR-CLIP	22100165
MIRT450097	hsa-miR-1257	PAR-CLIP	22100165
MIRT450096	hsa-miR-3136-5p	PAR-CLIP	22100165
MIRT450095	hsa-miR-4439	PAR-CLIP	22100165
MIRT450094	hsa-miR-943	PAR-CLIP	22100165
MIRT450101	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT450102	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT450100	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT450099	hsa-miR-595	PAR-CLIP	22100165
MIRT450098	hsa-miR-3163	PAR-CLIP	22100165
MIRT450097	hsa-miR-1257	PAR-CLIP	22100165
MIRT450096	hsa-miR-3136-5p	PAR-CLIP	22100165
MIRT450095	hsa-miR-4439	PAR-CLIP	22100165
MIRT450094	hsa-miR-943	PAR-CLIP	22100165
MIRT1394193	hsa-miR-2114	CLIP-seq
MIRT1394194	hsa-miR-3125	CLIP-seq
MIRT1394195	hsa-miR-3143	CLIP-seq
MIRT1394196	hsa-miR-3146	CLIP-seq
MIRT1394197	hsa-miR-340	CLIP-seq
MIRT1394198	hsa-miR-3665	CLIP-seq
MIRT1394199	hsa-miR-3690	CLIP-seq
MIRT1394200	hsa-miR-3916	CLIP-seq
MIRT1394201	hsa-miR-4292	CLIP-seq
MIRT1394202	hsa-miR-4308	CLIP-seq
MIRT1394203	hsa-miR-4436b-3p	CLIP-seq
MIRT1394204	hsa-miR-4461	CLIP-seq
MIRT1394205	hsa-miR-4535	CLIP-seq
MIRT1394206	hsa-miR-4676-5p	CLIP-seq
MIRT1394207	hsa-miR-4685-5p	CLIP-seq
MIRT1394208	hsa-miR-4712-3p	CLIP-seq
MIRT1394209	hsa-miR-4736	CLIP-seq
MIRT1394210	hsa-miR-492	CLIP-seq
MIRT1394211	hsa-miR-526b	CLIP-seq
MIRT1394212	hsa-miR-543	CLIP-seq
MIRT1394213	hsa-miR-575	CLIP-seq
MIRT1394214	hsa-miR-621	CLIP-seq
MIRT1394215	hsa-miR-627	CLIP-seq
MIRT2340351	hsa-miR-1972	CLIP-seq
MIRT2340352	hsa-miR-24	CLIP-seq
MIRT2340353	hsa-miR-2467-5p	CLIP-seq
MIRT2340354	hsa-miR-3065-3p	CLIP-seq
MIRT2340355	hsa-miR-4459	CLIP-seq
MIRT2340356	hsa-miR-4640-5p	CLIP-seq
MIRT2340357	hsa-miR-4695-5p	CLIP-seq
MIRT2340358	hsa-miR-4726-5p	CLIP-seq
MIRT2340359	hsa-miR-4755-3p	CLIP-seq
MIRT2340360	hsa-miR-665	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	ISS
GO:0000139	Component	Golgi membrane	TAS
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IEA
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	25416956, 33961781
GO:0005794	Component	Golgi apparatus	IEA
GO:0005975	Process	Carbohydrate metabolic process	TAS	9199191
GO:0006486	Process	Protein glycosylation	IBA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006491	Process	N-glycan processing	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006688	Process	Glycosphingolipid biosynthetic process	IEA
GO:0006688	Process	Glycosphingolipid biosynthetic process	ISS
GO:0006688	Process	Glycosphingolipid biosynthetic process	TAS	9199191
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	ISS
GO:0008373	Function	Sialyltransferase activity	TAS	9199191
GO:0009311	Process	Oligosaccharide metabolic process	IBA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

MIM	HGNC	e!Ensembl
607162	17827	ENSG00000101638

O15466

Protein name

Alpha-2,8-sialyltransferase 8E (EC 2.4.99.-) (Sialyltransferase 8E) (SIAT8-E) (Sialyltransferase St8Sia V) (ST8SiaV)

Protein function

Involved in the synthesis of gangliosides GD1c, GT1a, GQ1b, GP1c and GT3 from GD1a, GT1b, GM1b and GD3 respectively.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	116 → 370	Glycosyltransferase family 29 (sialyltransferase)	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed in fetal and adult brain, adult heart and skeletal muscle. {ECO:0000269|PubMed:9199191}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in fetal and adult brain, not detected in adult heart and skeletal muscle. {ECO

Sequence

MRYADPSANRDLLGSRTLLFIFICAFALVTLLQQILYGRNYIKRYFEFYEGPFEYNSTRC
LELRHEILEVKVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTT
QKNTPLGTKLKYEVDTSGIYHINQEIFRMFPKDMPYYRSQFKKCAVVGNGGILKNSRCGR
EINSADFVFRCNLPPISEKYTMDVGVKTDVVTVNPSIITERFHKLEKWRRPFYRVLQVYE
NASVLLPAFYNTRNTDVSIRVKYVLDDFESPQAVYYFHPQYLVNVSRYWLSLGVRAKRIS
TGLILVTAALELCEEVHLFGFWAFPMNPSGLYITHHYYDNVKPRPGFHAMPSEIFNFLHL
HSRGILRVHTGTCSCC

Sequence length

376

Interactions

View interactions

	KEGG		Reactome
	Glycosphingolipid biosynthesis - ganglio series Metabolic pathways		Sialic acid metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Atrial Fibrillation	Associate	36226239	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	34129933	★★★★★ ★☆☆☆☆ Found in Text Mining only

ST8SIA5 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5)