Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29883
Gene name Gene Name - the full gene name approved by the HGNC.
CCR4-NOT transcription complex subunit 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CNOT7
Synonyms (NCBI Gene) Gene synonyms aliases
CAF-1, CAF1, Caf1a, hCAF-1
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, caus
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT031760 hsa-miR-16-5p Proteomics 18668040
MIRT044358 hsa-miR-106b-5p CLASH 23622248
MIRT044358 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT440918 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT044358 hsa-miR-106b-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000175 Function 3'-5'-RNA exonuclease activity IDA 15769875
GO:0000288 Process Nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay IBA
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening IDA 21336257
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening IEA
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening NAS 31320642
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604913 14101 ENSG00000198791
Protein
UniProt ID Q9UIV1
Protein name CCR4-NOT transcription complex subunit 7 (EC 3.1.13.4) (BTG1-binding factor 1) (CCR4-associated factor 1) (CAF-1) (Caf1a)
Protein function Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate (PubMed:19276069, PubMed:20634287, PubMed:31439799). Its function seems to be partially redundant with that of CNOT8 (PubMed:19605561). Catalytic component of the CCR
PDB 2D5R , 4GMJ , 7AX1 , 7VOI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04857 CAF1 15 139 CAF1 family ribonuclease Family
PF04857 CAF1 133 238 CAF1 family ribonuclease Family
Sequence
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADY
QYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSG
IQFKKHEEEGIE
TQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELD
FFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAF
FK
MREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Sequence length 285
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  RNA degradation   Deadenylation of mRNA
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 33757599
Alzheimer Disease Associate 29935546
Breast Neoplasms Associate 33256566
Carcinoma Hepatocellular Associate 32160402
Carcinoma Squamous Cell Associate 26541675
Cognition Disorders Associate 33757599
Diabetes Mellitus Type 2 Associate 31797865
Immune System Diseases Associate 23386060
Neoplasms Associate 23386060, 30918060, 32160402
Virus Diseases Associate 23386060