Gene Gene information from NCBI Gene database.
Entrez ID 29883
Gene name CCR4-NOT transcription complex subunit 7
Gene symbol CNOT7
Synonyms (NCBI Gene)
CAF-1CAF1Caf1ahCAF-1
Chromosome 8
Chromosome location 8p22
Summary The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, caus
miRNA miRNA information provided by mirtarbase database.
432
miRTarBase ID miRNA Experiments Reference
MIRT031760 hsa-miR-16-5p Proteomics 18668040
MIRT044358 hsa-miR-106b-5p CLASH 23622248
MIRT044358 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT440918 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT044358 hsa-miR-106b-5p HITS-CLIP 22473208
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
58
GO ID Ontology Definition Evidence Reference
GO:0000175 Function 3'-5'-RNA exonuclease activity IDA 15769875
GO:0000288 Process Nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay IBA
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening IDA 21336257
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening IEA
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening NAS 31320642
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604913 14101 ENSG00000198791
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UIV1
Protein name CCR4-NOT transcription complex subunit 7 (EC 3.1.13.4) (BTG1-binding factor 1) (CCR4-associated factor 1) (CAF-1) (Caf1a)
Protein function Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate (PubMed:19276069, PubMed:20634287, PubMed:31439799). Its function seems to be partially redundant with that of CNOT8 (PubMed:19605561). Catalytic component of the CCR
PDB 2D5R , 4GMJ , 7AX1 , 7VOI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04857 CAF1 15 139 CAF1 family ribonuclease Family
PF04857 CAF1 133 238 CAF1 family ribonuclease Family
Sequence
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADY
QYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSG
IQFKKHEEEGIE
TQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELD
FFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAF
FK
MREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Sequence length 285
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  RNA degradation   Deadenylation of mRNA
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain