GUCA2B (guanylate cyclase activator 2B)

Gene

• Entrez ID: 2981
• Gene name: Guanylate cyclase activator 2B
• Gene symbol: GUCA2B
• Synonyms (NCBI Gene): GCAP-II, UGN
• Chromosome: 1
• Chromosome location: 1p34.2
• Summary: This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this pep

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017706	hsa-miR-335-5p	Microarray	18185580
MIRT2007864	hsa-miR-4435	CLIP-seq
MIRT2007865	hsa-miR-591	CLIP-seq
MIRT2240513	hsa-miR-4433	CLIP-seq
MIRT2007864	hsa-miR-4435	CLIP-seq
MIRT2240514	hsa-miR-4459	CLIP-seq
MIRT2240515	hsa-miR-4768-3p	CLIP-seq
MIRT2007865	hsa-miR-591	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HSF1	Repression	22129966

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002023	Process	Reduction of food intake in response to dietary excess	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007589	Process	Body fluid secretion	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0019934	Process	CGMP-mediated signaling	IEA
GO:0030250	Function	Guanylate cyclase activator activity	IBA
GO:0030250	Function	Guanylate cyclase activator activity	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070294	Process	Renal sodium ion absorption	IEA
GO:0097009	Process	Energy homeostasis	IEA

Other IDs

• MIM: 601271
• HGNC: 4683
• e!Ensembl: ENSG00000044012

Protein

• UniProt ID: Q16661
• Protein name: Guanylate cyclase activator 2B [Cleaved into: Guanylate cyclase C-activating peptide 2 (Guanylate cyclase C-activating peptide II) (GCAP-II); Uroguanylin (UGN)]
• Protein function: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May
• PDB: 1UYA, 1UYB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02058	Guanylin	26 → 111	Guanylin precursor	Family

• Tissue specificity: TISSUE SPECIFICITY: Stomach and intestine.
• Sequence:

  MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQ
  SLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

• Sequence length: 112

Pathways

KEGG:

Hormone signaling

Reactome:

Digestion

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinogenesis	Associate	33919332	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Inhibit	27125248	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	21352556, 32797167, 33919332, 34954189, 36991484	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	35151227	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus Syndrome	Inhibit	34954189	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Associate	24763552	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Stimulate	15780094	★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	37517791	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21352556	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Stimulate	15780094	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non alcoholic Fatty Liver Disease	Inhibit	37517791	★☆☆☆☆ Found in Text Mining only
Obesity	Inhibit	28847213, 29112082, 37517791	★☆☆☆☆ Found in Text Mining only