Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29781
Gene name Gene Name - the full gene name approved by the HGNC.	Non-SMC condensin II complex subunit H2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NCAPH2
Synonyms (NCBI Gene) Gene synonyms aliases	CAPH2
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of the non-SMC subunits of the condensin II complex. This complex plays an essential role in mitotic chromosome assembly. Alternate splicing of this gene results in multiple transcript variants.[provided by RefSeq, May 2010]

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016269	hsa-miR-193b-3p	Microarray	20304954
MIRT022333	hsa-miR-124-3p	Microarray	18668037
MIRT1175866	hsa-miR-105	CLIP-seq
MIRT1175867	hsa-miR-125a-3p	CLIP-seq
MIRT1175868	hsa-miR-1587	CLIP-seq
MIRT1175869	hsa-miR-205	CLIP-seq
MIRT1175870	hsa-miR-3670	CLIP-seq
MIRT1175871	hsa-miR-3934	CLIP-seq
MIRT1175872	hsa-miR-3942-3p	CLIP-seq
MIRT1175873	hsa-miR-4293	CLIP-seq
MIRT1175874	hsa-miR-4417	CLIP-seq
MIRT1175875	hsa-miR-4468	CLIP-seq
MIRT1175876	hsa-miR-4492	CLIP-seq
MIRT1175877	hsa-miR-4498	CLIP-seq
MIRT1175878	hsa-miR-4505	CLIP-seq
MIRT1175879	hsa-miR-4656	CLIP-seq
MIRT1175880	hsa-miR-4675	CLIP-seq
MIRT1175881	hsa-miR-4741	CLIP-seq
MIRT1175882	hsa-miR-4792	CLIP-seq
MIRT1175883	hsa-miR-646	CLIP-seq
MIRT1175884	hsa-miR-762	CLIP-seq
MIRT1175885	hsa-miR-764	CLIP-seq
MIRT1175886	hsa-miR-1295	CLIP-seq
MIRT1175887	hsa-miR-3166	CLIP-seq
MIRT1175888	hsa-miR-3194-5p	CLIP-seq
MIRT1175875	hsa-miR-4468	CLIP-seq
MIRT1175889	hsa-miR-4640-5p	CLIP-seq
MIRT1175890	hsa-miR-4726-5p	CLIP-seq
MIRT1175891	hsa-miR-665	CLIP-seq
MIRT1175886	hsa-miR-1295	CLIP-seq
MIRT1175891	hsa-miR-665	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000793	Component	Condensed chromosome	IEA
GO:0000796	Component	Condensin complex	IBA	21873635
GO:0003682	Function	Chromatin binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	17268547, 25910212, 26496610
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0007076	Process	Mitotic chromosome condensation	ISS
GO:0010032	Process	Meiotic chromosome condensation	IBA	21873635
GO:0016020	Component	Membrane	HDA	19946888
GO:0030054	Component	Cell junction	IDA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0051306	Process	Mitotic sister chromatid separation	IBA	21873635
GO:0051309	Process	Female meiosis chromosome separation	IEA

MIM	HGNC	e!Ensembl
611230	25071	ENSG00000025770

Protein

UniProt ID

Q6IBW4

Protein name

Condensin-2 complex subunit H2 (Chromosome-associated protein H2) (hCAP-H2) (Kleisin-beta) (Non-SMC condensin II complex subunit H2)

Protein function

Regulatory subunit of the condensin-2 complex, a complex that seems to provide chromosomes with an additional level of organization and rigidity and in establishing mitotic chromosome architecture (PubMed:14532007). May promote the resolution of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06278	CNDH2_N	11 → 123	Condensin II complex subunit CAP-H2 or CNDH2, N-terminal	Family
PF16869	CNDH2_M	147 → 287	Condensin II complex subunit CAP-H2 or CNDH2, mid domain	Family
PF16858	CNDH2_C	316 → 595	Condensin II complex subunit CAP-H2 or CNDH2, C-term	Family

Sequence

MEDVEARFAHLLQPIRDLTKNWEVDVAAQLGEYLEELDQICISFDEGKTTMNFIEAALLI
QGSACVYSKKVEYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLS
LDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFR
MNTCVPHPRGAFMLEPEGMSPMEPAGVSPMPGTQKDTGRTEEQPMEVSVCRSPVPALGFS
QEPGPSPEGPMPLGGGEDEDAEEAVELPEASAPKAALEPKESRSPQQSAALPRRYMLRER
EGAPEPASCVKETPDPWQSLDPFDSLESKPFKKGRPYSVPPCVEEALGQKRKRKGAAKLQ
DFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPA
EEDHLEDSLEDLGAADDFLEPEEYMEPEGADPREAADLDAVPMSLSYEELVRRNVELFIA
TSQKFVQETELSQRIRDWEDTVQPLLQEQEQHVPFDIHTYGDQLVSRFPQLNEWCPFAEL
VAGQPAFEVCRSMLASLQLANDYTVEITQQPGLEMAVDTMSLRLLTHQRAHKRFQTYAAP
SMAQP

Sequence length

605

Interactions

View interactions

	Reactome
			Condensation of Prophase Chromosomes

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Cardioencephalomyopathy	Cardioencephalomyopathy, Fatal Infantile, due to Cytochrome C Oxidase Deficiency	rs74315510, rs80358232, rs74315511, rs74315512, rs1467767014, rs28937868, rs121908508, rs28939711, rs387907099, rs1558123786, rs875989827, rs749838192, rs782349178, rs149718203, rs1603441682
Cardiomyopathy	Cardiomyopathy, Dilated	rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377 View all (900 more)	20159436
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962 View all (38 more)	28112199
Myopia	MYOPIA 6 (disorder)	rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805 View all (6 more)

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	26742120
Ataxia Telangiectasia	Associate	33078399
Carcinoma Hepatocellular	Associate	37166013
Cognitive Dysfunction	Associate	26742120
Microcephaly Primary Autosomal Recessive 1	Associate	23983231
Neoplasms	Associate	33078399, 37166013
Obesity	Associate	28211912
Squamous Cell Carcinoma of Head and Neck	Associate	36097539
Telomeric 22q13 Monosomy Syndrome	Associate	33078399

NCAPH2 (non-SMC condensin II complex subunit H2)