Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29781
Gene name Gene Name - the full gene name approved by the HGNC.	Non-SMC condensin II complex subunit H2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NCAPH2
Synonyms (NCBI Gene) Gene synonyms aliases	CAPH2
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of the non-SMC subunits of the condensin II complex. This complex plays an essential role in mitotic chromosome assembly. Alternate splicing of this gene results in multiple transcript variants.[provided by RefSeq, May 2010]

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016269	hsa-miR-193b-3p	Microarray	20304954
MIRT022333	hsa-miR-124-3p	Microarray	18668037
MIRT1175866	hsa-miR-105	CLIP-seq
MIRT1175867	hsa-miR-125a-3p	CLIP-seq
MIRT1175868	hsa-miR-1587	CLIP-seq
MIRT1175869	hsa-miR-205	CLIP-seq
MIRT1175870	hsa-miR-3670	CLIP-seq
MIRT1175871	hsa-miR-3934	CLIP-seq
MIRT1175872	hsa-miR-3942-3p	CLIP-seq
MIRT1175873	hsa-miR-4293	CLIP-seq
MIRT1175874	hsa-miR-4417	CLIP-seq
MIRT1175875	hsa-miR-4468	CLIP-seq
MIRT1175876	hsa-miR-4492	CLIP-seq
MIRT1175877	hsa-miR-4498	CLIP-seq
MIRT1175878	hsa-miR-4505	CLIP-seq
MIRT1175879	hsa-miR-4656	CLIP-seq
MIRT1175880	hsa-miR-4675	CLIP-seq
MIRT1175881	hsa-miR-4741	CLIP-seq
MIRT1175882	hsa-miR-4792	CLIP-seq
MIRT1175883	hsa-miR-646	CLIP-seq
MIRT1175884	hsa-miR-762	CLIP-seq
MIRT1175885	hsa-miR-764	CLIP-seq
MIRT1175886	hsa-miR-1295	CLIP-seq
MIRT1175887	hsa-miR-3166	CLIP-seq
MIRT1175888	hsa-miR-3194-5p	CLIP-seq
MIRT1175875	hsa-miR-4468	CLIP-seq
MIRT1175889	hsa-miR-4640-5p	CLIP-seq
MIRT1175890	hsa-miR-4726-5p	CLIP-seq
MIRT1175891	hsa-miR-665	CLIP-seq
MIRT1175886	hsa-miR-1295	CLIP-seq
MIRT1175891	hsa-miR-665	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000793	Component	Condensed chromosome	IEA
GO:0000794	Component	Condensed nuclear chromosome	IEA
GO:0000794	Component	Condensed nuclear chromosome	ISO
GO:0000796	Component	Condensin complex	IBA
GO:0000796	Component	Condensin complex	IEA
GO:0000796	Component	Condensin complex	NAS	17268547
GO:0003682	Function	Chromatin binding	IBA
GO:0005515	Function	Protein binding	IPI	17268547, 25416956, 25910212, 26496610, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005694	Component	Chromosome	IEA
GO:0007076	Process	Mitotic chromosome condensation	IEA
GO:0007076	Process	Mitotic chromosome condensation	ISS
GO:0007143	Process	Female meiotic nuclear division	IEA
GO:0010032	Process	Meiotic chromosome condensation	IBA
GO:0010032	Process	Meiotic chromosome condensation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0030054	Component	Cell junction	IDA
GO:0030261	Process	Chromosome condensation	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0051306	Process	Mitotic sister chromatid separation	IBA
GO:0051306	Process	Mitotic sister chromatid separation	IEA
GO:0051309	Process	Female meiosis chromosome separation	IEA
GO:0051984	Process	Positive regulation of chromosome segregation	IEA
GO:0051984	Process	Positive regulation of chromosome segregation	ISO
GO:1905820	Process	Positive regulation of chromosome separation	IEA
GO:1905820	Process	Positive regulation of chromosome separation	ISO
GO:1905821	Process	Positive regulation of chromosome condensation	ISS

MIM	HGNC	e!Ensembl
611230	25071	ENSG00000025770

Protein

UniProt ID

Q6IBW4

Protein name

Condensin-2 complex subunit H2 (Chromosome-associated protein H2) (hCAP-H2) (Kleisin-beta) (Non-SMC condensin II complex subunit H2)

Protein function

Regulatory subunit of the condensin-2 complex, a complex that seems to provide chromosomes with an additional level of organization and rigidity and in establishing mitotic chromosome architecture (PubMed:14532007). May promote the resolution of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06278	CNDH2_N	11 → 123	Condensin II complex subunit CAP-H2 or CNDH2, N-terminal	Family
PF16869	CNDH2_M	147 → 287	Condensin II complex subunit CAP-H2 or CNDH2, mid domain	Family
PF16858	CNDH2_C	316 → 595	Condensin II complex subunit CAP-H2 or CNDH2, C-term	Family

Sequence

MEDVEARFAHLLQPIRDLTKNWEVDVAAQLGEYLEELDQICISFDEGKTTMNFIEAALLI
QGSACVYSKKVEYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLS
LDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFR
MNTCVPHPRGAFMLEPEGMSPMEPAGVSPMPGTQKDTGRTEEQPMEVSVCRSPVPALGFS
QEPGPSPEGPMPLGGGEDEDAEEAVELPEASAPKAALEPKESRSPQQSAALPRRYMLRER
EGAPEPASCVKETPDPWQSLDPFDSLESKPFKKGRPYSVPPCVEEALGQKRKRKGAAKLQ
DFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPA
EEDHLEDSLEDLGAADDFLEPEEYMEPEGADPREAADLDAVPMSLSYEELVRRNVELFIA
TSQKFVQETELSQRIRDWEDTVQPLLQEQEQHVPFDIHTYGDQLVSRFPQLNEWCPFAEL
VAGQPAFEVCRSMLASLQLANDYTVEITQQPGLEMAVDTMSLRLLTHQRAHKRFQTYAAP
SMAQP

Sequence length

605

Interactions

View interactions

	Reactome
			Condensation of Prophase Chromosomes

NCAPH2 (non-SMC condensin II complex subunit H2)