ABT1 (activator of basal transcription 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 29777
Gene name Activator of basal transcription 1
Gene symbol ABT1
Synonyms (NCBI Gene)
Esf2hABT1
Chromosome 6
Chromosome location 6p22.2
Summary Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by this gene likely activates basal transcription from
miRNA miRNA information provided by mirtarbase database.
629
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (629)
miRTarBase ID miRNA Experiments Reference
MIRT023111 hsa-miR-124-3p Microarray 18668037
MIRT026032 hsa-miR-196a-5p Sequencing 20371350
MIRT027859 hsa-miR-98-5p Microarray 19088304
MIRT032165 hsa-let-7d-5p Sequencing 20371350
MIRT044910 hsa-miR-186-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (21)
GO ID Ontology Definition Evidence Reference
GO:0000447 Process Endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) IBA
GO:0000472 Process Endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) IBA
GO:0000480 Process Endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
618750 17369 ENSG00000146109
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9ULW3
Protein name Activator of basal transcription 1 (hABT1) (Basal transcriptional activator)
Protein function Could be a novel TATA-binding protein (TBP) which can function as a basal transcription activator. Can act as a regulator of basal transcription for class II genes (By similarity).
Family and domains
Sequence 
MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPL
HVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKR
VAASLHNTPMGARRRSPFRYDLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKR
ETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRARKAARPGGRERARLATAQ
DKARSNKGLLARIFGAPPPSESMEGPSLVRDS
Sequence length 272
Interactions View interactions