Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29761
Gene name	Ubiquitin specific peptidase 25
Gene symbol	USP25
Synonyms (NCBI Gene)	EIG19USP21
Chromosome	21
Chromosome location	21q21.1
Summary	Ubiquitin (MIM 191339) is a highly conserved 76-amino acid protein involved in regulation of intracellular protein breakdown, cell cycle regulation, and stress response. Ubiquitin is released from degraded proteins by disassembly of the polyubiquitin chai

236

Show/Hide all (236)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022093	hsa-miR-128-3p	Sequencing	20371350
MIRT027319	hsa-miR-101-3p	Sequencing	20371350
MIRT028715	hsa-miR-27a-3p	Sequencing	20371350
MIRT039252	hsa-miR-454-5p	CLASH	23622248
MIRT053466	hsa-miR-200c-3p	Microarray	23807165
MIRT053466	hsa-miR-200c-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayQRTPCRWestern blot	24997798
MIRT565065	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT565068	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT565067	hsa-miR-3925-5p	PAR-CLIP	20371350
MIRT565066	hsa-miR-3123	PAR-CLIP	20371350
MIRT565065	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT022093	hsa-miR-128-3p	PAR-CLIP	20371350
MIRT565064	hsa-miR-216a-3p	PAR-CLIP	20371350
MIRT565063	hsa-miR-3681-3p	PAR-CLIP	20371350
MIRT565062	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT565061	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT565060	hsa-miR-513a-5p	PAR-CLIP	20371350
MIRT028715	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT565059	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT509940	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509939	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509938	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT509937	hsa-miR-567	PAR-CLIP	21572407
MIRT509936	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509935	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT546119	hsa-miR-4666a-5p	PAR-CLIP	21572407
MIRT509934	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509933	hsa-miR-297	PAR-CLIP	21572407
MIRT509940	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509939	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509938	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509937	hsa-miR-567	PAR-CLIP	23446348
MIRT509936	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509935	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT509934	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509933	hsa-miR-297	PAR-CLIP	23446348
MIRT565065	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT565068	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT565067	hsa-miR-3925-5p	PAR-CLIP	20371350
MIRT565066	hsa-miR-3123	PAR-CLIP	20371350
MIRT565065	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT022093	hsa-miR-128-3p	PAR-CLIP	20371350
MIRT565064	hsa-miR-216a-3p	PAR-CLIP	20371350
MIRT565063	hsa-miR-3681-3p	PAR-CLIP	20371350
MIRT565062	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT565061	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT565060	hsa-miR-513a-5p	PAR-CLIP	20371350
MIRT028715	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT565059	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT509940	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509939	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509938	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT509937	hsa-miR-567	PAR-CLIP	21572407
MIRT509936	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509935	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT546119	hsa-miR-4666a-5p	PAR-CLIP	21572407
MIRT509934	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509933	hsa-miR-297	PAR-CLIP	21572407
MIRT509940	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509939	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509938	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509937	hsa-miR-567	PAR-CLIP	23446348
MIRT509936	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509935	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT509934	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509933	hsa-miR-297	PAR-CLIP	23446348
MIRT1478392	hsa-miR-1184	CLIP-seq
MIRT1478393	hsa-miR-1205	CLIP-seq
MIRT1478394	hsa-miR-1231	CLIP-seq
MIRT1478395	hsa-miR-128	CLIP-seq
MIRT1478396	hsa-miR-144	CLIP-seq
MIRT1478397	hsa-miR-15a	CLIP-seq
MIRT1478398	hsa-miR-15b	CLIP-seq
MIRT1478399	hsa-miR-16	CLIP-seq
MIRT1478400	hsa-miR-195	CLIP-seq
MIRT1478401	hsa-miR-2355-3p	CLIP-seq
MIRT1478402	hsa-miR-25	CLIP-seq
MIRT1478403	hsa-miR-27a	CLIP-seq
MIRT1478404	hsa-miR-27b	CLIP-seq
MIRT1478405	hsa-miR-3158-5p	CLIP-seq
MIRT1478406	hsa-miR-3163	CLIP-seq
MIRT1478407	hsa-miR-32	CLIP-seq
MIRT1478408	hsa-miR-323-3p	CLIP-seq
MIRT1478409	hsa-miR-339-3p	CLIP-seq
MIRT1478410	hsa-miR-345	CLIP-seq
MIRT1478411	hsa-miR-346	CLIP-seq
MIRT1478412	hsa-miR-3591-3p	CLIP-seq
MIRT1478413	hsa-miR-363	CLIP-seq
MIRT1478414	hsa-miR-3662	CLIP-seq
MIRT1478415	hsa-miR-367	CLIP-seq
MIRT1478416	hsa-miR-374c	CLIP-seq
MIRT1478417	hsa-miR-3923	CLIP-seq
MIRT1478418	hsa-miR-424	CLIP-seq
MIRT1478419	hsa-miR-4277	CLIP-seq
MIRT1478420	hsa-miR-4288	CLIP-seq
MIRT1478421	hsa-miR-4303	CLIP-seq
MIRT1478422	hsa-miR-4422	CLIP-seq
MIRT1478423	hsa-miR-4477a	CLIP-seq
MIRT1478424	hsa-miR-4477b	CLIP-seq
MIRT1478425	hsa-miR-4524	CLIP-seq
MIRT1478426	hsa-miR-4659a-5p	CLIP-seq
MIRT1478427	hsa-miR-4659b-5p	CLIP-seq
MIRT1478428	hsa-miR-4664-3p	CLIP-seq
MIRT1478429	hsa-miR-4742-3p	CLIP-seq
MIRT1478430	hsa-miR-4776-3p	CLIP-seq
MIRT1478431	hsa-miR-4789-5p	CLIP-seq
MIRT1478432	hsa-miR-497	CLIP-seq
MIRT1478433	hsa-miR-499-3p	CLIP-seq
MIRT1478434	hsa-miR-499a-3p	CLIP-seq
MIRT1478435	hsa-miR-502-5p	CLIP-seq
MIRT1478436	hsa-miR-503	CLIP-seq
MIRT1478437	hsa-miR-518a-5p	CLIP-seq
MIRT1478438	hsa-miR-527	CLIP-seq
MIRT1478439	hsa-miR-548ac	CLIP-seq
MIRT1478440	hsa-miR-548ae	CLIP-seq
MIRT1478441	hsa-miR-548aj	CLIP-seq
MIRT1478442	hsa-miR-548am	CLIP-seq
MIRT1478443	hsa-miR-548d-3p	CLIP-seq
MIRT1478444	hsa-miR-548x	CLIP-seq
MIRT1478445	hsa-miR-548z	CLIP-seq
MIRT1478446	hsa-miR-616	CLIP-seq
MIRT1478447	hsa-miR-622	CLIP-seq
MIRT1478448	hsa-miR-632	CLIP-seq
MIRT1478449	hsa-miR-646	CLIP-seq
MIRT1478450	hsa-miR-654-3p	CLIP-seq
MIRT1478451	hsa-miR-655	CLIP-seq
MIRT1478452	hsa-miR-671-3p	CLIP-seq
MIRT1478453	hsa-miR-676	CLIP-seq
MIRT1478454	hsa-miR-758	CLIP-seq
MIRT1478455	hsa-miR-92a	CLIP-seq
MIRT1478456	hsa-miR-92b	CLIP-seq
MIRT2144095	hsa-miR-3148	CLIP-seq
MIRT2144096	hsa-miR-3169	CLIP-seq
MIRT1478409	hsa-miR-339-3p	CLIP-seq
MIRT1478414	hsa-miR-3662	CLIP-seq
MIRT2144097	hsa-miR-4263	CLIP-seq
MIRT1478419	hsa-miR-4277	CLIP-seq
MIRT1478421	hsa-miR-4303	CLIP-seq
MIRT2144098	hsa-miR-450b-5p	CLIP-seq
MIRT2144099	hsa-miR-4515	CLIP-seq
MIRT1478428	hsa-miR-4664-3p	CLIP-seq
MIRT2144100	hsa-miR-4670-3p	CLIP-seq
MIRT2144101	hsa-miR-4700-3p	CLIP-seq
MIRT2144102	hsa-miR-4729	CLIP-seq
MIRT2144103	hsa-miR-4789-3p	CLIP-seq
MIRT1478431	hsa-miR-4789-5p	CLIP-seq
MIRT2144104	hsa-miR-4799-5p	CLIP-seq
MIRT1478433	hsa-miR-499-3p	CLIP-seq
MIRT1478434	hsa-miR-499a-3p	CLIP-seq
MIRT2144105	hsa-miR-507	CLIP-seq
MIRT2144106	hsa-miR-511	CLIP-seq
MIRT2144107	hsa-miR-548aa	CLIP-seq
MIRT2144108	hsa-miR-557	CLIP-seq
MIRT2144109	hsa-miR-576-5p	CLIP-seq
MIRT2144110	hsa-miR-579	CLIP-seq
MIRT2144111	hsa-miR-642b	CLIP-seq
MIRT1478450	hsa-miR-654-3p	CLIP-seq
MIRT1478452	hsa-miR-671-3p	CLIP-seq
MIRT2144112	hsa-miR-875-3p	CLIP-seq
MIRT1478392	hsa-miR-1184	CLIP-seq
MIRT1478393	hsa-miR-1205	CLIP-seq
MIRT1478394	hsa-miR-1231	CLIP-seq
MIRT1478395	hsa-miR-128	CLIP-seq
MIRT1478396	hsa-miR-144	CLIP-seq
MIRT1478403	hsa-miR-27a	CLIP-seq
MIRT1478404	hsa-miR-27b	CLIP-seq
MIRT1478405	hsa-miR-3158-5p	CLIP-seq
MIRT2364325	hsa-miR-3202	CLIP-seq
MIRT2364326	hsa-miR-320a	CLIP-seq
MIRT2364327	hsa-miR-320b	CLIP-seq
MIRT2364328	hsa-miR-320c	CLIP-seq
MIRT2364329	hsa-miR-320d	CLIP-seq
MIRT1478408	hsa-miR-323-3p	CLIP-seq
MIRT1478409	hsa-miR-339-3p	CLIP-seq
MIRT1478410	hsa-miR-345	CLIP-seq
MIRT1478411	hsa-miR-346	CLIP-seq
MIRT1478414	hsa-miR-3662	CLIP-seq
MIRT2364330	hsa-miR-3688-3p	CLIP-seq
MIRT2364331	hsa-miR-369-3p	CLIP-seq
MIRT2364332	hsa-miR-374a	CLIP-seq
MIRT2364333	hsa-miR-374b	CLIP-seq
MIRT1478416	hsa-miR-374c	CLIP-seq
MIRT1478417	hsa-miR-3923	CLIP-seq
MIRT2364334	hsa-miR-3924	CLIP-seq
MIRT2364335	hsa-miR-3978	CLIP-seq
MIRT2364336	hsa-miR-411	CLIP-seq
MIRT2364337	hsa-miR-4275	CLIP-seq
MIRT1478419	hsa-miR-4277	CLIP-seq
MIRT1478420	hsa-miR-4288	CLIP-seq
MIRT1478421	hsa-miR-4303	CLIP-seq
MIRT2364338	hsa-miR-4429	CLIP-seq
MIRT2364339	hsa-miR-4494	CLIP-seq
MIRT2364340	hsa-miR-4499	CLIP-seq
MIRT2364341	hsa-miR-4533	CLIP-seq
MIRT2364342	hsa-miR-4661-3p	CLIP-seq
MIRT1478428	hsa-miR-4664-3p	CLIP-seq
MIRT2364343	hsa-miR-4672	CLIP-seq
MIRT2364344	hsa-miR-4687-3p	CLIP-seq
MIRT2364345	hsa-miR-4694-3p	CLIP-seq
MIRT2144102	hsa-miR-4729	CLIP-seq
MIRT1478429	hsa-miR-4742-3p	CLIP-seq
MIRT2144103	hsa-miR-4789-3p	CLIP-seq
MIRT2364346	hsa-miR-4790-3p	CLIP-seq
MIRT2364347	hsa-miR-487b	CLIP-seq
MIRT2364348	hsa-miR-490-5p	CLIP-seq
MIRT1478433	hsa-miR-499-3p	CLIP-seq
MIRT1478434	hsa-miR-499a-3p	CLIP-seq
MIRT2364349	hsa-miR-512-3p	CLIP-seq
MIRT2364350	hsa-miR-522	CLIP-seq
MIRT2144110	hsa-miR-579	CLIP-seq
MIRT1478447	hsa-miR-622	CLIP-seq
MIRT1478448	hsa-miR-632	CLIP-seq
MIRT1478450	hsa-miR-654-3p	CLIP-seq
MIRT1478451	hsa-miR-655	CLIP-seq
MIRT1478452	hsa-miR-671-3p	CLIP-seq
MIRT1478395	hsa-miR-128	CLIP-seq
MIRT2364343	hsa-miR-4672	CLIP-seq
MIRT2364344	hsa-miR-4687-3p	CLIP-seq
MIRT2364345	hsa-miR-4694-3p	CLIP-seq
MIRT2144102	hsa-miR-4729	CLIP-seq
MIRT2364347	hsa-miR-487b	CLIP-seq
MIRT2364349	hsa-miR-512-3p	CLIP-seq
MIRT2364350	hsa-miR-522	CLIP-seq
MIRT1478406	hsa-miR-3163	CLIP-seq
MIRT2658126	hsa-miR-3688-5p	CLIP-seq
MIRT1478422	hsa-miR-4422	CLIP-seq
MIRT2658127	hsa-miR-4470	CLIP-seq
MIRT2658128	hsa-miR-4476	CLIP-seq
MIRT1478426	hsa-miR-4659a-5p	CLIP-seq
MIRT1478427	hsa-miR-4659b-5p	CLIP-seq
MIRT2658129	hsa-miR-4668-3p	CLIP-seq
MIRT1478430	hsa-miR-4776-3p	CLIP-seq
MIRT2658126	hsa-miR-3688-5p	CLIP-seq
MIRT1478422	hsa-miR-4422	CLIP-seq
MIRT2658127	hsa-miR-4470	CLIP-seq
MIRT2658128	hsa-miR-4476	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	18538659
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	10644437
GO:0005515	Function	Protein binding	IPI	18538659, 21516116, 22153077, 25416956, 28514442, 31515488, 32296183, 32707033, 32814053, 33060197, 33961781, 34232536, 35914814, 36217029
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	2304215, 19440361
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	38875478
GO:0005783	Component	Endoplasmic reticulum	IDA	22590560
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	10644437
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	TAS	10644437
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016579	Process	Protein deubiquitination	IDA	22590560
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019783	Function	Ubiquitin-like protein peptidase activity	NAS	22590560
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22590560
GO:0031647	Process	Regulation of protein stability	IBA
GO:0032183	Function	SUMO binding	IBA
GO:0032183	Function	SUMO binding	IPI	18538659
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0036211	Process	Protein modification process	TAS	10644437
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	31376257, 35183823
GO:0043130	Function	Ubiquitin binding	NAS	22590560
GO:0051117	Function	ATPase binding	IPI	22590560
GO:0070536	Process	Protein K63-linked deubiquitination	IMP	18538659
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29658272
GO:0071108	Process	Protein K48-linked deubiquitination	IMP	18538659
GO:0101005	Function	Deubiquitinase activity	IDA	23042150, 37339955
GO:0101005	Function	Deubiquitinase activity	IMP	38875478
GO:1902883	Process	Negative regulation of response to oxidative stress	IDA	11027288, 15601839
GO:1902883	Process	Negative regulation of response to oxidative stress	IDA	37339955
GO:1903882	Process	Negative regulation of interleukin-17-mediated signaling pathway	IDA	23042150
GO:1904293	Process	Negative regulation of ERAD pathway	IMP	22590560

MIM	HGNC	e!Ensembl
604736	12624	ENSG00000155313

Q9UHP3

Protein name

Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.4.19.12) (Deubiquitinating enzyme 25) (USP on chromosome 21) (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25)

Protein function

Deubiquitinating enzyme that hydrolyzes ubiquitin moieties conjugated to substrates and thus, functions in various biological processes including inflammation and immune response (PubMed:29518389, PubMed:37683630). Modulates the Wnt/beta-catenin

PDB

2MUX , 5GP7 , 5O71 , 6H4J , 6H4K , 6HEL , 6HEM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02809	UIM	97 → 113	Ubiquitin interaction motif	Motif
PF02809	UIM	124 → 140	Ubiquitin interaction motif	Motif
PF00443	UCH	169 → 654	Ubiquitin carboxyl-terminal hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform USP25a is found in most adult and fetal tissues; expression is moderately high in testis, pancreas, kidney, skeletal muscle, liver, lung, placenta, heart, but very low in peripheral blood, colon, small intestine, ovary, prostat

Sequence

MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAK
TPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRET
GITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWF
SAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYV
DPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELFY
GRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIK
RLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPPSG
SIPSQTLPSTTEQQGALSSELPSTSPSSVAAISSRSVIHKPFTQSRIPPDLPMHPAPRHI
TEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHE
GQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDKAQ
FLIQEEFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQ
KLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIQIITKASHEHEDKSPETVLQSA
IKLEYARLVKLAQEDTPPETDYRLHHVVVYFIQNQAPKKIIEKTLLEQFGDRNLSFDERC
HNIMKVAQAKLEMIKPEEVNLEEYEEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFL
ICAYQNNKELLSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNE
FIVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIK
SFHEPPKLPSYSTHELCERFARIMLSLSRTPADGR

Sequence length

1055

Interactions

View interactions

	KEGG		Reactome
	IL-17 signaling pathway		Ub-specific processing proteases

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Mesothelioma	Uncertain significance	rs200318307	RCV005932212

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Aneuploidy	Associate	11597335
Carcinogenesis	Associate	30926243
Carcinoma Non Small Cell Lung	Associate	34533198
Colorectal Neoplasms	Associate	32578360
Crohn Disease	Associate	25489960
Down Syndrome	Associate	11597335
Glioma	Associate	35450028
Neoplasms	Associate	30926243, 33202887, 34533198
Non alcoholic Fatty Liver Disease	Associate	20473581

USP25 (ubiquitin specific peptidase 25)