Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2961
Gene name Gene Name - the full gene name approved by the HGNC.
General transcription factor IIE subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GTF2E2
Synonyms (NCBI Gene) Gene synonyms aliases
FE, TF2E2, TFIIE-B, TTD6
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p12
Summary Summary of gene provided in NCBI Entrez Gene.
The general transcription factor IIE (TFIIE) is part of the RNA polymerase II transcription initiation complex, recruiting TFIIH and being essential for promoter clearance by RNA polymerase II. TFIIE is a heterodimer (and sometimes heterotetramer) of alph
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs875989846 C>G Pathogenic Coding sequence variant, missense variant
rs875989847 C>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT039017 hsa-miR-766-3p CLASH 23622248
MIRT544520 hsa-miR-548av-3p PAR-CLIP 21572407
MIRT544519 hsa-miR-548g-3p PAR-CLIP 21572407
MIRT544518 hsa-miR-100-3p PAR-CLIP 21572407
MIRT544516 hsa-miR-6500-3p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001097 Function TFIIH-class transcription factor complex binding IBA
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding HDA 22658674
GO:0005515 Function Protein binding IPI 7926747, 8999876, 9271120, 16547462, 21988832, 28514442, 32296183, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
189964 4651 ENSG00000197265
Protein
UniProt ID P29084
Protein name Transcription initiation factor IIE subunit beta (TFIIE-beta) (General transcription factor IIE subunit 2)
Protein function Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase. {ECO:0000269|PubMed:
PDB 1D8J , 1D8K , 5GPY , 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6O9L , 7EG9 , 7EGA , 7EGB , 7EGC , 7ENA , 7ENC , 7LBM , 7NVR , 7NVS , 7NVT , 7NVU , 7NVY , 7NVZ , 7NW0 , 8BVW , 8BYQ , 8GXQ , 8GXS , 8S51 , 8S52 , 8S55 , 8S5N , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP , 8WAQ , 8WAR , 8WAS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02186 TFIIE_beta 74 145 TFIIE beta subunit core domain Domain
PF18121 TFA2_Winged_2 146 204 TFA2 Winged helix domain 2 Domain
Sequence
MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNG
SFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLM
TEALVNNPKIEVIDGKYAFKPKYNV
RDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQK
AVKALGDQILFVNRPDKKKILFFN
DKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
Sequence length 291
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Basal transcription factors
Viral carcinogenesis
  RNA Polymerase II Pre-transcription Events
RNA polymerase II transcribes snRNA genes
RNA Polymerase II Promoter Escape
RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
RNA Polymerase II Transcription Initiation
RNA Polymerase II Transcription Initiation And Promoter Clearance
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Trichothiodystrophy trichothiodystrophy 6, nonphotosensitive rs875989846, rs875989847 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Renal Cell Associate 35954157
Fever Associate 28973399
Hematologic Neoplasms Associate 28973399
Neoplasms Associate 35954157
Trichothiodystrophy Syndromes Associate 26996949, 28973399, 30580289