Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2959
Gene name Gene Name - the full gene name approved by the HGNC.
General transcription factor IIB
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GTF2B
Synonyms (NCBI Gene) Gene synonyms aliases
TF2B, TFIIB
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p22.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors II
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003079 hsa-miR-122-5p qRT-PCR 18073344
MIRT003079 hsa-miR-122-5p qRT-PCR 18073344
MIRT041771 hsa-miR-484 CLASH 23622248
MIRT540156 hsa-miR-4432 HITS-CLIP 23706177
MIRT541939 hsa-miR-508-5p HITS-CLIP 23706177
Transcription factors
Transcription factor Regulation Reference
RELA Activation 7706261
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000979 Function RNA polymerase II core promoter sequence-specific DNA binding IBA 21873635
GO:0000979 Function RNA polymerase II core promoter sequence-specific DNA binding IDA 7675079, 9420329, 10619841, 16230532
GO:0000993 Function RNA polymerase II complex binding IDA 8413225, 8504927
GO:0001174 Process Transcriptional start site selection at RNA polymerase II promoter IBA 21873635
GO:0001174 Process Transcriptional start site selection at RNA polymerase II promoter IMP 10318856
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
189963 4648 ENSG00000137947
Protein
UniProt ID Q00403
Protein name Transcription initiation factor IIB (EC 2.3.1.48) (General transcription factor TFIIB) (S300-II)
Protein function General transcription factor that plays a role in transcription initiation by RNA polymerase II (Pol II). Involved in the pre-initiation complex (PIC) formation and Pol II recruitment at promoter DNA (PubMed:12931194, PubMed:1517211, PubMed:1876
PDB 1C9B , 1DL6 , 1RLY , 1RO4 , 1TFB , 1VOL , 2PHG , 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 5WH1 , 6O9L , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7ENA , 7ENC , 7LBM , 7NVR , 7NVS , 7NVT , 7NVU , 7NVY , 7NVZ , 7NW0 , 7ZWC , 7ZWD , 7ZX7 , 7ZX8 , 7ZXE , 8BVW , 8BYQ , 8BZ1 , 8GXQ , 8GXS , 8S51 , 8S52 , 8S5N , 8WAK , 8WAL , 8WAN , 8WAO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08271 TF_Zn_Ribbon 13 55 TFIIB zinc-binding Domain
PF00382 TFIIB 121 191 Transcription factor TFIIB repeat Domain
PF00382 TFIIB 215 285 Transcription factor TFIIB repeat Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the inner cell mass forming the embryoblast (PubMed:24441171). Not detected in cells from the outer thin layer trophoblast (at protein level) (PubMed:24441171). {ECO:0000269|PubMed:24441171}.
Sequence
MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEI
GRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTI
RQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL
Sequence length 316
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Basal transcription factors
Spinocerebellar ataxia
Viral carcinogenesis
  RNA Polymerase II Pre-transcription Events
RNA polymerase II transcribes snRNA genes
RNA Polymerase II Promoter Escape
RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
RNA Polymerase II Transcription Initiation
RNA Polymerase II Transcription Initiation And Promoter Clearance
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Unknown
Disease term Disease name Evidence References Source
Hypertension Hypertension GWAS
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 23055019
Inflammation Associate 29709033
Ovarian Neoplasms Inhibit 29048667