Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2952
Gene name Gene Name - the full gene name approved by the HGNC.	Glutathione S-transferase theta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GSTT1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene, glutathione S-transferase (GST) theta 1 (GSTT1), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be div

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments
MIRT1036664	hsa-miR-1193	CLIP-seq
MIRT1036665	hsa-miR-1294	CLIP-seq
MIRT1036666	hsa-miR-3689d	CLIP-seq
MIRT1036667	hsa-miR-4450	CLIP-seq
MIRT1036668	hsa-miR-4710	CLIP-seq
MIRT1036669	hsa-miR-491-5p	CLIP-seq
MIRT1036664	hsa-miR-1193	CLIP-seq
MIRT2007348	hsa-miR-1264	CLIP-seq
MIRT1036665	hsa-miR-1294	CLIP-seq
MIRT2007349	hsa-miR-3199	CLIP-seq
MIRT1036666	hsa-miR-3689d	CLIP-seq
MIRT2007350	hsa-miR-4314	CLIP-seq
MIRT1036667	hsa-miR-4450	CLIP-seq
MIRT2007351	hsa-miR-4663	CLIP-seq
MIRT1036668	hsa-miR-4710	CLIP-seq
MIRT1036669	hsa-miR-491-5p	CLIP-seq
MIRT2007352	hsa-miR-635	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	9307035, 9434735, 20097269
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IDA	9307035, 9434735
GO:0005515	Function	Protein binding	IPI	25910212, 28514442, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	8799324
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	9307035, 9434735, 20097269
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
600436	4641	HGNC

Protein

UniProt ID

P30711

Protein name

Glutathione S-transferase theta-1 (EC 2.5.1.18) (GST class-theta-1) (Glutathione transferase T1-1)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. Displays glutath

PDB

2C3N , 2C3Q , 2C3T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13417	GST_N_3	5 → 83	Glutathione S-transferase, N-terminal domain	Domain
PF00043	GST_C	111 → 201	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in erythrocyte. Expressed at low levels in liver. In lung, expressed at low levels in club cells and ciliated cells at the alveolar/bronchiolar junction. Absent from epithelial cells of larger bronchioles. {ECO:0000269|PubMed:876

Sequence

MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF
PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
GCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Sequence length

240

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Glutathione conjugation

GSTT1 (glutathione S-transferase theta 1)