GSTP1 (glutathione S-transferase pi 1)

Gene

• Entrez ID: 2950
• Gene name: Glutathione S-transferase pi 1
• Gene symbol: GSTP1
• Synonyms (NCBI Gene): DFN7, FAEES3, GST3, GSTP, HEL-S-22, PI
• Chromosome: 11
• Chromosome location: 11q13.2
• Summary: Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and st

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1695	A>G	Not-provided, drug-response	Missense variant, coding sequence variant
rs1555022268	TC>CA	Likely-pathogenic	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006966	hsa-miR-513a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22749944
MIRT006966	hsa-miR-513a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22749944
MIRT021715	hsa-miR-133a-3p	Reporter assay;Microarray	21396852
MIRT029320	hsa-miR-26b-5p	Microarray	19088304
MIRT049201	hsa-miR-92a-3p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
CDX2	Unknown	22580340
FOS	Unknown	8206948
JUN	Unknown	8206948
MBD2	Repression	11960994;12543808;19856314
MBD2	Unknown	11406558
NFKB1	Activation	15013838
RELA	Activation	15013838
SP1	Activation	8557630
TP53	Activation	18505928

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	ISS
GO:0002674	Process	Negative regulation of acute inflammatory response	NAS	18962899
GO:0004364	Function	Glutathione transferase activity	IBA	21873635
GO:0004364	Function	Glutathione transferase activity	IDA	1540159, 9084911
GO:0004602	Function	Glutathione peroxidase activity	IDA	16624487
GO:0005504	Function	Fatty acid binding	IPI	16624487
GO:0005515	Function	Protein binding	IPI	16636664, 23164639, 24965446, 25241761, 25416956, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006469	Process	Negative regulation of protein kinase activity	IDA	16636664
GO:0006693	Process	Prostaglandin metabolic process	IDA	9084911
GO:0006749	Process	Glutathione metabolic process	IBA	21873635
GO:0006749	Process	Glutathione metabolic process	IDA	1540159
GO:0006805	Process	Xenobiotic metabolic process	IDA	1540159
GO:0007417	Process	Central nervous system development	TAS	9802272
GO:0008144	Function	Drug binding	IEA
GO:0008432	Function	JUN kinase binding	ISS
GO:0009890	Process	Negative regulation of biosynthetic process	IDA	18962899
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IC	16636664
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0019207	Function	Kinase regulator activity	ISS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032355	Process	Response to estradiol	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IDA	18962899
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	18962899
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032872	Process	Regulation of stress-activated MAPK cascade	ISS
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	ISS
GO:0032930	Process	Positive regulation of superoxide anion generation	ISS
GO:0033591	Process	Response to L-ascorbic acid	IEA
GO:0034599	Process	Cellular response to oxidative stress	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035726	Process	Common myeloid progenitor cell proliferation	ISS
GO:0035730	Function	S-nitrosoglutathione binding	IDA	11533048
GO:0035731	Function	Dinitrosyl-iron complex binding	IDA	11533048, 12871945
GO:0035732	Process	Nitric oxide storage	NAS	12871931
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0043124	Process	Negative regulation of I-kappaB kinase/NF-kappaB signaling	ISS
GO:0043200	Process	Response to amino acid	IEA
GO:0043295	Function	Glutathione binding	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043407	Process	Negative regulation of MAP kinase activity	IDA	11408560
GO:0043409	Process	Negative regulation of MAPK cascade	NAS	18962899
GO:0043508	Process	Negative regulation of JUN kinase activity	IDA	16636664
GO:0043651	Process	Linoleic acid metabolic process	IDA	16624487
GO:0045471	Process	Response to ethanol	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	ISS
GO:0051122	Process	Hepoxilin biosynthetic process	IDA	21046276
GO:0051771	Process	Negative regulation of nitric-oxide synthase biosynthetic process	IDA	18962899
GO:0070026	Function	Nitric oxide binding	NAS	11533048
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	11408560
GO:0070664	Process	Negative regulation of leukocyte proliferation	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IEA
GO:0071460	Process	Cellular response to cell-matrix adhesion	IEA
GO:0071638	Process	Negative regulation of monocyte chemotactic protein-1 production	IDA	18962899
GO:0071672	Process	Negative regulation of smooth muscle cell chemotaxis	IEA
GO:0097057	Component	TRAF2-GSTP1 complex	IDA	16636664
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1901687	Process	Glutathione derivative biosynthetic process	IDA	9084911
GO:1901687	Process	Glutathione derivative biosynthetic process	TAS
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IDA	16636664

Other IDs

• MIM: 134660
• HGNC: 4638
• e!Ensembl: ENSG00000084207

Protein

• UniProt ID: P09211
• Protein name: Glutathione S-transferase P (EC 2.5.1.18) (GST class-pi) (GSTP1-1)
• Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911). Particip
• PDB: 10GS, 11GS, 12GS, 13GS, 14GS, 16GS, 17GS, 18GS, 19GS, 1AQV, 1AQW, 1AQX, 1EOG, 1EOH, 1GSS, 1KBN, 1LBK, 1MD3, 1MD4, 1PGT, 1PX6, 1PX7, 1ZGN, 20GS, 22GS, 2A2R, 2A2S, 2GSS, 2J9H, 2PGT, 3CSH, 3CSI, 3CSJ, 3DD3, 3DGQ, 3GSS, 3GUS, 3HJM, 3HJO, 3HKR, 3IE3, 3KM6, 3KMN, 3KMO, 3N9J, 3PGT, 4GSS, 4PGT, 5DAK, 5DAL, 5DCG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02798	GST_N	4 → 75	Glutathione S-transferase, N-terminal domain	Domain
  PF14497	GST_C_3	98 → 197	Glutathione S-transferase, C-terminal domain	Domain

• Sequence:

  MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
  LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
  KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
  VGRLSARPKLKAFLASPEYVNLPINGNGKQ

• Sequence length: 210

Pathways

KEGG:

Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Prostate cancer
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Reactome:

Glutathione conjugation
Detoxification of Reactive Oxygen Species
Neutrophil degranulation

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis, Amyotrophic Lateral Sclerosis, Guam Form	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733, rs80356731, rs80356726, rs267606928, rs267606929, rs121434591, rs121912431, rs121912432, rs121912433, rs121912434, rs121912435, rs121912440, rs121912436, rs121912437, rs121912438, rs121912439, rs74315452, rs121912442, rs121912443, rs121912444, rs121912446, rs121912447, rs1197141604, rs121912448, rs121912449, rs121912450, rs121912451, rs121912452, rs121912453, rs121912454, rs369600566, rs121912455, rs121912456, rs121912457, rs121912458, rs1555836889, rs121909667, rs121909668, rs121909669, rs121909671, rs121909535, rs121909537, rs121909538, rs121909539, rs121909540, rs121909542, rs121909544, rs80356734, rs367543041, rs80356740, rs80356719, rs80356721, rs80356723, rs80356725, rs387906627, rs387906628, rs387906709, rs387906710, rs387906711, rs387906829, rs387907264, rs387907265, rs387907266, rs312262739, rs312262709, rs312262749, rs200793464, rs147713329, rs312262788, rs397514262, rs63751180, rs587777132, rs730880025, rs730880026, rs730880027, rs368743618, rs730880029, rs730882255, rs730882256, rs786205611, rs121912441, rs199947197, rs780136067, rs772731615, rs879253926, rs879254294, rs764717219, rs886041390, rs750159428, rs753207473, rs267607087, rs767350733, rs778305085, rs1554707680, rs1554707622, rs1393363759, rs750959420, rs1555509569, rs1554716504, rs11556620, rs1247392012, rs142083484, rs140385286, rs371575563, rs1402429085, rs1555179091, rs1555179087, rs746971952, rs1555836950, rs368276916, rs140376902, rs747220413, rs76731700, rs770684782, rs1200906022, rs1804449, rs1482760341, rs769898852, rs140599944, rs757972700, rs1555451521, rs1592362719, rs1555836803, rs763455928, rs1378590183, rs1583695322, rs1362178149, rs1197928094, rs368751524, rs1555509609, rs1574787779, rs1601157750, rs1301635320, rs1341055534, rs1402092579, rs1568809172, rs1555836170, rs1315541036, rs1339283341, rs1643659556, rs1644506661, rs1435710212, rs1553122918, rs1689580631, rs374047961, rs775935265, rs2076486420, rs1820836522, rs757260058, rs1844420892, rs1833371664, rs1833438306, rs1833451208, rs2083790483, rs1303294230, rs1226110412, rs2053207945, rs2053208751, rs2053501632, rs2053539304, rs1567479067, rs544088874, rs1228194239, rs1568807400, rs1169198442, rs2049594204, rs2049594311, rs1568810641, rs1568811372, rs2049618449, rs1476760624, rs2079347087	16109392
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542	17404132
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243	25322848
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	25322848
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	11196146
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	21133646, 21364753
Glioma	Glioma, mixed gliomas, Malignant Glioma	rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499, rs1060500122, rs781647403, rs1060500126, rs1554897889, rs1114167629, rs1114167656, rs587782603, rs1554893824, rs1554900615, rs1564568660, rs786204900, rs762518389, rs1339631701	16899598
Hypertension	Hypertensive disease	rs13306026	24915237
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	12868187
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	17094902
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	17909032
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465, rs137854466, rs137854467, rs387906547, rs387906548, rs137854469, rs137854473, rs1131692050, rs112989722, rs137854474, rs137854476, rs140593, rs1555395819, rs137854478, rs137854479, rs137854480, rs137854481, rs137854482, rs137854483, rs137854484, rs137854485, rs112289537, rs193922181, rs193922182, rs193922185, rs140603, rs193922187, rs193922188, rs193921256, rs112660651, rs193922193, rs193922194, rs193922197, rs193922198, rs193922199, rs193922203, rs193922204, rs193922205, rs193922206, rs111401431, rs193922207, rs113871094, rs111671429, rs193922216, rs193922219, rs193922220, rs193922223, rs193922224, rs193922225, rs193922226, rs193922227, rs193922228, rs193922230, rs193922235, rs147195031, rs193922236, rs193922239, rs193922240, rs193922241, rs193922246, rs397514558, rs398122934, rs397515753, rs397515754, rs397515755, rs397515756, rs397515757, rs113812345, rs397515758, rs397515759, rs397515762, rs25403, rs397515765, rs397515766, rs397515767, rs397515768, rs397515769, rs397515770, rs397515771, rs25404, rs397515773, rs397515774, rs397515775, rs397515776, rs397515778, rs397515779, rs397515781, rs112202622, rs397515782, rs397515784, rs397515785, rs397515786, rs397515788, rs397515789, rs397515790, rs397515791, rs397515792, rs397515793, rs397515794, rs397515797, rs397515798, rs397515799, rs397515801, rs397515802, rs397515803, rs397515804, rs397515805, rs397515808, rs397515810, rs397515811, rs397515812, rs111231312, rs267606798, rs397515814, rs113905529, rs397515816, rs397515817, rs397515818, rs397515819, rs397515820, rs363853, rs113249837, rs397515821, rs111929350, rs397515823, rs397515824, rs113086760, rs397515825, rs397515826, rs397515827, rs363807, rs397515828, rs397515829, rs397515830, rs397515831, rs397515833, rs111687884, rs113080385, rs397515834, rs397515836, rs113001196, rs397515840, rs397515845, rs397515846, rs397515847, rs397515848, rs397515851, rs397515852, rs397515853, rs397515854, rs111856492, rs397515859, rs397515861, rs397515863, rs397515864, rs397515865, rs397515866, rs397515867, rs137854855, rs199474693, rs587782944, rs587782947, rs587782948, rs672601352, rs876658120, rs727504651, rs727503054, rs727504315, rs727504411, rs727503057, rs727504454, rs200309328, rs363811, rs727504410, rs363821, rs727504347, rs727505006, rs727505110, rs730880356, rs727505269, rs727503058, rs727504421, rs730880107, rs730880104, rs730880103, rs730880102, rs730880101, rs730880106, rs730880100, rs730880105, rs730880099, rs112645512, rs730880108, rs730880098, rs730880097, rs794728321, rs794728283, rs794728280, rs794728336, rs794728272, rs794728160, rs794728271, rs794728270, rs794728319, rs794728262, rs794728251, rs76702162, rs794728335, rs794728334, rs794728246, rs763091520, rs794728333, rs794728237, rs761857514, rs794728234, rs140630, rs794728231, rs794728228, rs794728225, rs794728308, rs794728216, rs794728221, rs763449629, rs201058219, rs794728210, rs794728208, rs794728206, rs794728199, rs794728195, rs794728194, rs794728193, rs794728190, rs1555399381, rs794728176, rs1555399968, rs113422242, rs794728326, rs794728166, rs794728325, rs794728165, rs794728162, rs794728213, rs869025417, rs112642323, rs869025416, rs869025415, rs869025424, rs869025423, rs869025414, rs869025422, rs869025413, rs869025412, rs869025411, rs869025418, rs869025426, rs869025406, rs869025421, rs869025425, rs869025404, rs869025420, rs869025403, rs398122833, rs876657645, rs878853686, rs878853676, rs886038919, rs886038795, rs187553035, rs886038869, rs886038949, rs886038967, rs886038976, rs886038848, rs886038940, rs886038877, rs886039038, rs886038817, rs886038963, rs886039036, rs886038797, rs886039550, rs886041482, rs1057517855, rs1057518912, rs1057518973, rs1057519502, rs1057521100, rs1057521102, rs1057518881, rs1057520617, rs1057521101, rs1555394445, rs369058466, rs1060501069, rs1060501031, rs778966916, rs1060501043, rs1555397663, rs1060501017, rs1060501094, rs1060501065, rs1555393848, rs1555394151, rs1060501051, rs1060501013, rs1060501054, rs1060501048, rs1060501089, rs1060501039, rs1555398160, rs1060501022, rs1060501024, rs1060501086, rs1060501058, rs1060501036, rs1060501100, rs1060501042, rs1060501059, rs1555397743, rs1060501021, rs1060501027, rs1060501096, rs1060501038, rs1060501050, rs1064794130, rs112118237, rs1064793980, rs1064793118, rs1064793636, rs1064794282, rs1064793559, rs1085307921, rs1085308004, rs1085307468, rs112907302, rs1131691479, rs1131691373, rs1131691467, rs1131691938, rs1131691311, rs1131691806, rs1131691317, rs1555393827, rs363804, rs1555397738, rs1555399144, rs1555400274, rs1555394195, rs1555398836, rs113543334, rs1555399825, rs1555394626, rs1555395256, rs1555395257, rs1555396427, rs1555397548, rs1555398173, rs1555404803, rs1232880706, rs1555393825, rs1555394567, rs1555396998, rs1555394928, rs1555397203, rs112375043, rs1555397720, rs140599, rs1555399150, rs1555400373, rs1555405041, rs1555395229, rs1555397671, rs775417975, rs1555398774, rs1555399368, rs1555394904, rs1555395987, rs1555397424, rs1555398377, rs1555398835, rs1555401011, rs1555405043, rs1555394580, rs1555397404, rs1555398511, rs1555395826, rs1555399372, rs1555399821, rs1555399836, rs1555400063, rs363810, rs1555397655, rs1555395756, rs1555395742, rs1555393844, rs112550005, rs1555395002, rs1555395658, rs765387131, rs1555396429, rs1555396835, rs1555397014, rs1555397016, rs778710767, rs1555397557, rs1555397704, rs140648, rs1555398406, rs1555398681, rs1555399257, rs1555399361, rs1555399764, rs1555405056, rs1555393510, rs1555395980, rs1555396789, rs1555399094, rs1555399378, rs1555399816, rs1555395645, rs371097218, rs1555398278, rs1555394238, rs1555396418, rs1206813753, rs1555399271, rs1555405044, rs113544411, rs1555395663, rs1555397216, rs1555398989, rs1555399149, rs1555401670, rs1555395001, rs1445085747, rs1555393538, rs1555393565, rs1404133653, rs1555394450, rs1555394581, rs1555394633, rs1555394900, rs1555395189, rs1555395261, rs1052480459, rs1555395480, rs1555395670, rs363806, rs1555395820, rs1555396419, rs1555396765, rs1296209846, rs794728233, rs1555396853, rs1555396863, rs1555397197, rs1555397204, rs1555397212, rs1555397713, rs1555397736, rs1555398139, rs1555398144, rs1555398409, rs1555398510, rs1555398520, rs1555398524, rs1555398667, rs1555399089, rs1555399482, rs1555399763, rs1555401002, rs794728323, rs1555393508, rs1555393514, rs1555393525, rs1555393532, rs1555393653, rs1555393657, rs1555393824, rs1555393831, rs112196241, rs1555393847, rs1555393862, rs1555393863, rs1555393866, rs113935744, rs1555393882, rs1555393886, rs1555393889, rs1555394138, rs1555394144, rs1555394146, rs1555394148, rs1555394149, rs1555394152, rs1555394153, rs1555394189, rs1555394197, rs1555394206, rs1555394212, rs1555394218, rs1555394220, rs1555394235, rs1555394245, rs1555394246, rs1057520728, rs1555394390, rs1555394391, rs537570299, rs1555394397, rs1555394398, rs1555394399, rs1555394402, rs1555394407, rs1555394412, rs1555394435, rs1555394436, rs1555394441, rs1555394556, rs1555394557, rs1555394559, rs1555394561, rs1555394570, rs397515844, rs1555394571, rs1555394574, rs1555394579, rs1555394582, rs534811966, rs111588631, rs1555394628, rs1555394629, rs1555394630, rs1555394631, rs1555394641, rs1555394644, rs1555394647, rs1555394756, rs886051245, rs1555394775, rs1555394776, rs1555394777, rs1555394779, rs1555394780, rs1555394783, rs1555394901, rs1555394906, rs1555394925, rs794728253, rs886039158, rs1555395013, rs1555395187, rs1555395188, rs1555395203, rs1555395205, rs363815, rs1246984265, rs794728245, rs1555395263, rs1555395267, rs1555395456, rs1555395475, rs1555395482, rs1555395638, rs1555395641, rs1555395648, rs1555395653, rs1555395659, rs111239111, rs1555395745, rs1555395747, rs1555395753, rs1555395757, rs1555395766, rs1555395767, rs1555395843, rs1555395846, rs1555395849, rs1555395978, rs1555395981, rs1555395984, rs1555395989, rs1555395990, rs1260109901, rs1555396186, rs1555396188, rs1555396198, rs1555396199, rs1555396201, rs1555396202, rs1555396205, rs1555396213, rs1555396424, rs1555396426, rs1555396428, rs1555396435, rs1555396630, rs1555396635, rs1555396636, rs1555396639, rs1555396757, rs1555396769, rs1555396838, rs1555396844, rs140627, rs1555396858, rs1555396990, rs1555396991, rs1555396993, rs769588424, rs1555397022, rs1555397024, rs1555397160, rs1555397174, rs1555397176, rs1555397193, rs1555397209, rs1555397210, rs1555397214, rs1060501076, rs113082854, rs113693945, rs111978932, rs1555397403, rs1555397419, rs1555397420, rs1555397421, rs1555397536, rs1555397537, rs1555397540, rs1555397542, rs1555397543, rs1555397545, rs1555397546, rs1555397670, rs1555397692, rs1555397718, rs1555397723, rs1555397744, rs113393517, rs1555398148, rs1555398152, rs1555398174, rs1555398176, rs1555398179, rs1555398282, rs1555398287, rs1555398380, rs1555398394, rs1555398397, rs1555398401, rs1555398404, rs1555398407, rs1555398413, rs1555398501, rs1555398508, rs1555398512, rs1555398513, rs1555398515, rs1555398521, rs794728205, rs1555398527, rs1555398551, rs1060501075, rs1555398566, rs1555398572, rs1555398580, rs1555398582, rs140597, rs1555398622, rs1555398624, rs1555398625, rs112547596, rs1555398627, rs1555398633, rs1555398637, rs1555398642, rs778867355, rs1555398648, rs1555398659, rs1293095681, rs1060501040, rs987202268, rs1555398672, rs1555398673, rs1555398677, rs1555398793, rs1555398803, rs1555398811, rs1555398826, rs1555398833, rs1555398974, rs1555398981, rs778900586, rs1555398988, rs1555398994, rs1555398995, rs1555398996, rs1555399093, rs869025405, rs1555399101, rs1555399146, rs1555399160, rs1555399162, rs1555399164, rs1555399165, rs1555399193, rs1555399195, rs1555399202, rs1555399204, rs1555399206, rs201778577, rs1555399210, rs1555399214, rs1555399270, rs1555399273, rs1555399281, rs1555399371, rs1555399385, rs1555399477, rs1555399484, rs1555399761, rs1555399775, rs1555399802, rs1555399804, rs1555399837, rs1555399840, rs1555399940, rs1555399944, rs1555399949, rs1555399953, rs1555399954, rs1555399955, rs1555399959, rs1555399962, rs1555399963, rs1060501041, rs1555399974, rs1555399976, rs1555399977, rs1555400049, rs794728172, rs1555400062, rs1555400064, rs1555400066, rs1555400267, rs1555400268, rs1555400278, rs794728168, rs1555400279, rs1156747241, rs1555400288, rs1555400371, rs1555400372, rs1555400379, rs1555400385, rs587782943, rs1555400387, rs1555400406, rs1439533354, rs746201757, rs1555400595, rs1555400603, rs1555400604, rs1555400606, rs1555400609, rs752010116, rs1555400612, rs1555400616, rs1555401004, rs1555401005, rs146348130, rs1555401667, rs1555401671, rs1555401676, rs1555401679, rs1555401687, rs1555401689, rs1555401695, rs1555401697, rs1555401701, rs1555404799, rs1555404800, rs200295020, rs1555404810, rs1555404820, rs1555405031, rs1555405039, rs1555405045, rs1555405530, rs794728292, rs1555405533, rs1555405536, rs1555405537, rs111764111, rs1555405658, rs1555405664, rs774371494, rs1555405673, rs1555407399, rs1555407414, rs1555407423, rs1555407429, rs886041536, rs1555404806, rs1566911709, rs1566913974, rs1566894226, rs1566895223, rs1566897376, rs1566902526, rs1566915277, rs1566897374, rs1566897420, rs1566891655, rs1346043320, rs1566922396, rs1566891706, rs1566894783, rs1566913670, rs1555394196, rs1566891454, rs1566891406, rs1566891404, rs1566895262, rs1566891645, rs1566895225, rs1566896114, rs1566898399, rs1566904011, rs1566906537, rs1566908956, rs1566909766, rs1566919599, rs1566937712, rs1566915335, rs1566891675, rs1566904526, rs1566906506, rs1566900540, rs1566894230, rs1555395206, rs1566891797, rs1597512576, rs1597523873, rs1597581001, rs1597516325, rs1057524757, rs1597506641, rs1597520781, rs1597593695, rs1597529829, rs1597520625, rs1597579923, rs1597531796, rs1008275504, rs1597567249, rs1597569265, rs1597652471, rs1597516347, rs1597577114, rs1597633163, rs1597519658, rs1597593852, rs1597516501, rs1566913982, rs1555393859, rs1597513708, rs368978109, rs1480832655, rs1597520683, rs1597522390, rs1597522553, rs1597529748, rs1597533707, rs1597537815, rs1597545309, rs1597545836, rs1597563234, rs1597563280, rs1597564359, rs772108557, rs1597568968, rs1597574236, rs1597574308, rs1597577975, rs193922179, rs1597581005, rs1597593736, rs1597623670, rs1597625734, rs1597631662, rs113604459, rs1597633183, rs1597633219, rs1597518951, rs1555394781, rs1597525871, rs1597526073, rs1597569159, rs1597569536, rs1597563934, rs1597545199, rs1364210063, rs1597552583, rs1597520619, rs1597540854, rs1597591602, rs1597569551, rs1597548716, rs1597553721, rs112728248, rs1597537858, rs1597517935, rs1597540907, rs1597552388, rs1597591643, rs1597529841, rs1597506547, rs1597509836, rs1597529686, rs1566897404, rs1597533713, rs1597543486, rs1597545257, rs1597545345, rs1597548672, rs1597562812, rs1597563287, rs1597571391, rs1555400052, rs1597583989, rs363852, rs1597547226, rs363808, rs974604498, rs2043595650, rs2043526284, rs2042997306, rs1555397195, rs886039054, rs1555397213, rs2042873946	25322848
Moyamoya disease	Arterial Diseases, Common Carotid	rs121434527, rs121434528, rs387906592, rs397514563, rs797045187, rs1555675538, rs1568149971, rs1599150380, rs2079443410	16973168
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	15108329
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121918104, rs1589451049, rs104893877, rs104893878, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106	17190945, 23721876
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	15538743, 17173048, 22581815, 19223546, 11196146
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	15108329
Sarcoma	Sarcoma, Epithelioid, Sarcoma, Spindle Cell, Sarcoma	rs11540652, rs104886003, rs137852790, rs1555927374	17152492
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	12691788, 25358668
Tremor	Essential Tremor, Familial Tremor	rs387907274, rs763485258, rs551348450	18215156

Unknown
Disease term	Disease name	Evidence	References	Source
Asthma	Asthma		11994713, 16870661, 29411558, 18988661	ClinVar
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma		15108329	ClinVar
Coronary syndrome	Acute Coronary Syndrome		21751358	ClinVar
Hodgkin lymphoma	Adult Hodgkin Lymphoma		11406608	ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
AA amyloidosis	Associate	32334487
Acne Vulgaris	Associate	37113088
Actinic Prurigo	Associate	18288203
Acute Disease	Associate	39873985
Acute Kidney Injury	Associate	28640195
Adenocarcinoma	Associate	12149142, 12937133, 22833520, 26306699, 26447830, 35842220
Adenocarcinoma	Inhibit	37347938
Adenocarcinoma Bronchiolo Alveolar	Associate	19484794
Adenocarcinoma of Lung	Associate	34596453, 38017020
Adenocarcinoma of Lung	Stimulate	36709476
Adenoma	Associate	18093316
Adenoma	Inhibit	18425080
Adenomatous Polyposis Coli	Associate	19470943, 22077694, 23874531, 25738352
Alcoholism	Associate	23857610
Allan Herndon Dudley syndrome	Associate	26195723
Anemia	Associate	32711417, 33280607, 33326171
Ascites	Associate	30313031
Ascorbic Acid Deficiency	Associate	19710200
Asthma	Associate	11686891, 14682402, 14748821, 16295782, 17497028, 17711870, 18057098, 18335111, 18988661, 20526719, 21103062, 21320344, 22228263, 22355322, 22610343, 23066387, 23357926, 23600543, 23663310, 24465030, 25895113, 26490046, 27561723, 32943407
Asthma Exercise Induced	Associate	22610343
Astrocytoma	Associate	20187096, 21128213, 26580399
Atrophy	Associate	28182092
Atrophy	Stimulate	37347938
Autism Spectrum Disorder	Associate	25101770, 27834815, 33546147, 35741737
Autoimmune Diseases	Associate	32231024
Azoospermia	Associate	25532576
Balkan Nephropathy	Associate	37629712
Blast Injuries	Associate	20843134
Brain Ischemia	Associate	31564827
Brain Neoplasms	Inhibit	24460273
Brain Neoplasms	Associate	31123752, 32526700
Breast Diseases	Associate	20627767
Breast Neoplasms	Associate	15565566, 16434992, 16672066, 17416769, 17611401, 17624589, 17683074, 17696741, 18326615, 18425393, 18485221, 18542066, 19379515, 19469640, 19921428, 19940364, 20568049, 20627767, 20696638, 20716965, 21454829, 21749698, 21837480, 22037257, 22052985, 22310978, 22320227, 22320983, 22564471, 22782090, 22986510, 23000097, 23244102, 23826324, 24093668, 24205493, 24535908, 25041782, 25119175, 25155055, 25375048, 25648141, 25674268, 26125851, 26452468, 26681014, 27323034, 27388253, 28222671, 28315507, 28443466, 28692125, 29116019, 30049201, 30461653, 30683915, 31450928, 32334487, 33064289, 33425072, 35729577, 35906899, 36308374, 37548362, 40156399, 7904475, 8206948, 9514046
Breast Neoplasms	Stimulate	30461653
Breast Neoplasms Male	Associate	22765268
Bronchial Hyperreactivity	Associate	20526719, 22228263
Burkitt Lymphoma	Associate	15003890
Cap Myopathy	Associate	10595928, 37347938
Carcinogenesis	Associate	12497653, 24377535, 24453034, 26476064, 30950439, 32183092, 40026294, 8546677
Carcinogenesis	Inhibit	22298307, 27594734
Carcinogenesis	Stimulate	32592358
Carcinoma Basal Cell	Associate	16582078
Carcinoma Bronchogenic	Associate	16255782
Carcinoma Ductal Breast	Associate	31450928
Carcinoma Hepatocellular	Associate	12937151, 14507645, 17690210, 20080086, 20331903, 22536438, 22994742, 23437062, 23569432, 25892883, 25923138, 26000761, 26260272, 26476064, 29085212, 31731000
Carcinoma Hepatocellular	Inhibit	29085212
Carcinoma Intraductal Noninfiltrating	Associate	20056007, 24093668
Carcinoma Non Small Cell Lung	Associate	16342067, 17409936, 19174490, 19568750, 22009704, 22031394, 22190510, 23167352, 24935385, 26028097, 26823821, 27323109, 27525853, 27706763, 28033105, 28442702, 29328427, 33099907
Carcinoma Ovarian Epithelial	Associate	22960333, 28365938, 30313031, 32711417
Carcinoma Pancreatic Ductal	Associate	17265526
Carcinoma Renal Cell	Associate	27500405, 33953831
Carcinoma Squamous Cell	Stimulate	11511301
Carcinoma Squamous Cell	Associate	12497653, 19047905
Carcinosarcoma	Associate	30101629
Cardiovascular Diseases	Associate	33035787
Cataract	Inhibit	33599104
Cholangiocarcinoma	Associate	12213730, 15467712, 15884115, 17550320
Chronic Periodontitis	Associate	36833382
Cirrhosis Familial	Associate	33978213
Cognition Disorders	Associate	21734345
Colitis Ulcerative	Associate	24651583
Colonic Diseases	Associate	15122305
Colorectal Neoplasms	Associate	15122305, 15770723, 16369045, 16425401, 18093316, 18267032, 18797455, 19124514, 19922504, 20047135, 20216541, 22390411, 22697302, 22994779, 24762493, 26043078, 30356976, 31389389, 31740522, 33035787, 33280607, 35195960
Colorectal Neoplasms	Stimulate	30694518, 35674599
Coronary Artery Disease	Associate	31275451, 40485517
Coronary Disease	Associate	34883250
COVID 19	Associate	35361071, 36834445
Cyclic neutropenia	Associate	21169260, 26432087, 38013655
Cystic Fibrosis	Associate	20140303, 23758905, 24593045
Death	Associate	20187096, 22938445, 22994742, 23167352, 23244102, 24040330, 25892883, 26097600, 26260272, 26681014, 26722539, 26823821, 27323109, 27706763, 28739440, 40284160
Death	Inhibit	26571237
Death	Stimulate	38554336
Dermatitis Atopic 1	Associate	23600543
Diabetes Mellitus	Associate	22732554, 28585914, 34643502, 36676788, 40485517
Diabetes Mellitus Type 1	Associate	36674274
Diabetes Mellitus Type 2	Associate	26435566, 33203728, 34883250, 36674274, 36676788, 36834424, 40485517
Diabetes Mellitus Type 2	Stimulate	36834424
Disease Resistance	Associate	15884115
DNA Virus Infections	Associate	22833520
Drug Hypersensitivity	Associate	18709160
Drug Related Side Effects and Adverse Reactions	Associate	11350797, 16546115, 18162130, 18425080, 21887680, 22868256, 25119182, 26028097, 26432087, 28085011, 28679691, 28844589, 30927276, 32711417, 33035787, 33280607, 33326171
Drug Resistant Epilepsy	Associate	16627975
Duane Retraction Syndrome	Associate	14682402
Dysplastic Nevus Syndrome	Associate	7904475
Dyspnea	Associate	16870661
Emphysema	Associate	17363767, 21734345
Endometrial Neoplasms	Associate	15681469, 35893933
Endometriosis	Stimulate	22424617
Enterocolitis Neutropenic	Associate	17409936
Esophageal Squamous Cell Carcinoma	Associate	20540773, 30499150
Esophageal Squamous Cell Carcinoma	Inhibit	22853296
Fat Necrosis	Associate	22272830
Fibrosis	Associate	22272830, 23597419, 25892883
Fluorosis Dental	Associate	26046522
Gallbladder Neoplasms	Associate	38554336
Gastritis	Associate	14507661
Gastritis Atrophic	Associate	29434449
Gastrointestinal Diseases	Associate	16995867
Glaucoma Open Angle	Associate	21738397
Glaucoma Open Angle	Inhibit	33599104
Glioblastoma	Associate	21128213, 24532427, 32526700
Glioblastoma	Inhibit	30321868
Glioblastoma	Stimulate	33087132
Head and Neck Neoplasms	Associate	21545198, 22799388, 22918668, 28686330, 30950439, 32592358
Hearing Disorders	Associate	23065688, 36397425
Hearing Loss	Associate	36397425
Heart Diseases	Associate	21887680
Heart Failure	Associate	31275451
Helicobacter Infections	Associate	23077566
Hematologic Diseases	Associate	17409936, 21169260, 22868256, 37058477
Hematuria	Associate	26354850
Hemorrhage	Associate	32541641
Hepatic Veno Occlusive Disease	Associate	26790967
Hepatitis B	Associate	22320227, 35729577
Hepatitis B Chronic	Associate	23569432
Hepatoblastoma	Associate	39684755
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30049201
HIV Infections	Associate	22114700
Hodgkin Disease	Associate	15788664
Hypersensitivity Immediate	Associate	23600543
Hypertension	Associate	20592457, 24915237
Hypertrophy	Associate	30765895
Hypoxia	Associate	33640700, 36709476
Ige Responsiveness Atopic	Associate	11686891, 14682402, 20526719
Infertility	Inhibit	22903474
Infertility	Associate	25532576
Infertility Male	Associate	22903474, 25532576, 34806654, 36254890
Inflammation	Associate	18709160, 23600543, 25041782
Inflammatory Bowel Diseases	Associate	25895113
Insulin Resistance	Associate	22732554
Intestinal Atresia	Associate	24367646
Intestinal Diseases	Associate	28182092
Kidney Failure Chronic	Associate	18067039, 27498857
Leukemia	Associate	11553769, 23082001
Leukemia B Cell	Associate	15003890, 15725081
Leukemia Hairy Cell	Associate	15003890
Leukemia Lymphocytic Chronic B Cell	Associate	12010828, 20029944, 32102530
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	20843134, 25436036, 31111691, 35527244
Leukemia Myeloid Acute	Associate	11553769, 23886197, 25799091, 26823947, 26960454, 37302023
Leukemia T Cell	Associate	18511072
Liver Cirrhosis	Associate	33291080
Liver Neoplasms	Associate	25293352
Lown Ganong Levine Syndrome	Associate	26097600
Lung Diseases	Associate	21734345, 28212552
Lung Injury	Associate	32943407
Lung Neoplasms	Associate	16342067, 16788248, 16933328, 19174490, 19282111, 19484794, 19887610, 20156772, 22206016, 24786234, 25040976, 25105437, 25122423, 27819744, 27903892, 28739440, 31127915, 31554367, 32648197, 34596453, 35469493, 36709476
Lupus Erythematosus Systemic	Associate	16995867, 17195228
Lupus Nephritis	Associate	27002825
Lymphatic Metastasis	Associate	18485221, 22320983, 23826324, 27388253, 36454866
Lymphoma	Associate	15231573, 23082001
Lymphoma B Cell	Associate	15003890
Lymphoma B Cell Marginal Zone	Associate	15003890, 15725081
Lymphoma Follicular	Associate	15003890
Lymphoma Large B Cell Diffuse	Associate	15003890, 15725081, 28039708
Lymphoma Non Hodgkin	Associate	19822571, 19899130, 20029944, 24998186
Lymphoma Non Hodgkin	Inhibit	19899130
Malaria Falciparum	Associate	19635899
Malnutrition	Associate	40284160
Medulloblastoma	Associate	23065688
Melanoma	Associate	15999103, 9877184
Melanoma Cutaneous Malignant	Associate	26427666
Meningeal Neoplasms	Stimulate	26580399
Mental Disorders	Associate	26354850
Mental Disorders	Stimulate	26354850
Mesothelioma Malignant	Associate	33544514
Microphthalmia Syndromic 10	Associate	25231845
Mitochondrial Diseases	Associate	31611630
Mohr Tranebjaerg syndrome	Stimulate	29328427
Mouth Diseases	Stimulate	12937133
Mouth Diseases	Inhibit	28182092
Mouth Neoplasms	Associate	17886251, 21545219, 29037125, 32265484, 36149156
Mucositis	Associate	25589620
Multiple Myeloma	Associate	12791655, 32937189
Multiple Sclerosis	Associate	25231845
Multiple Sclerosis	Inhibit	30063300
Myocardial Infarction	Associate	24915237
Myoclonic Epilepsies Progressive	Associate	26552558
Myopathy with Giant Abnormal Mitochondria	Associate	31611630
Myositis	Associate	12937133
Myositis	Stimulate	37347938
Nasopharyngeal Carcinoma	Associate	27149165
Nasopharyngeal Neoplasms	Associate	22393996, 27149165
Nausea	Associate	30870506
Necrosis	Stimulate	14710442
Neoplasm Invasiveness	Associate	15681469
Neoplasm Metastasis	Associate	33099907, 35195960, 36709476
Neoplasms	Inhibit	15467712, 17968429, 19383368, 20716965, 21622623, 21839064, 22139572, 22539223, 22542536, 24252461, 24935385, 26043078, 26447830, 28222671, 32466334, 34657877, 37548362
Neoplasms	Associate	15780023, 15942635, 16446401, 16627975, 16773633, 16803634, 17322540, 17624589, 18425080, 18505928, 18511072, 18825537, 19808963, 19861513, 19940364, 20540773, 20627767, 20696638, 20978370, 21128213, 21545198, 21830905, 22320227, 22390411, 22517484, 22672250, 22695536, 22744714, 22799388, 23106910, 23826324, 24377535, 24460273, 24521039, 24610081, 24998186, 25041782, 25122424, 25155055, 25216229, 25647260, 25684485, 26011342, 26086362, 26098903, 26370119, 26580399, 26960454, 27077777, 27576364, 28085011, 28198496, 28679691, 28739440, 28859615, 30043549, 30049201, 30321868, 30499150, 30950439, 31127915, 31389389, 31611630, 31666119, 32183092, 32859265, 33087132, 33640700, 33978213, 34563043, 35195960, 35238908, 35293017, 35842220, 35906899, 36709476, 38013655, 38115290, 39201484, 39684755, 40026294, 7904475, 8546677, 9514046
Neoplasms	Stimulate	32592358
Neoplasms Cystic Mucinous and Serous	Stimulate	15655543
Neoplasms Second Primary	Associate	19401526
Neoplasms Squamous Cell	Associate	22298307, 29479986
Nervous System Diseases	Associate	19922504, 20308030
Neuroectodermal Tumors Primitive	Associate	23065688
Neurotoxicity Syndromes	Associate	19922504, 20514304, 20530282, 22868256
Neutropenia	Associate	21169260, 22868256, 30927276, 35729577, 38013655
Non alcoholic Fatty Liver Disease	Associate	20805291, 34988225
Non Muscle Invasive Bladder Neoplasms	Associate	24040330, 24252461
Obesity	Associate	21266224
Oligospermia	Associate	23324581
Oropharyngeal Neoplasms	Associate	23523331
Osteoporosis	Associate	24593045
Osteoporosis pseudoglioma syndrome	Associate	8659519
Osteosarcoma	Associate	21887680, 22068640, 22938445, 23317281, 24841650, 24996541, 27525908
Ovarian Neoplasms	Associate	16773633, 25010864, 33273524, 36988399
Pancreatic Neoplasms	Associate	31602160, 31611630
Pancreatitis	Associate	34130200
Papillomavirus Infections	Associate	28829907, 29479986
Parkinson Disease	Associate	23857610
Paroxysmal ventricular fibrillation	Associate	27759448
Peripheral Nervous System Diseases	Associate	19223573, 36939926
Personality Disorders	Associate	23826324
Pituitary Neoplasms	Associate	18425080, 30321868
Polyneuropathies	Associate	22031394
Polyposis Syndrome Hereditary Mixed 1	Associate	18093316
Postoperative Nausea and Vomiting	Associate	30870506
Precancerous Conditions	Associate	10760690, 18425080, 22298307, 22320983, 26580399
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10666194, 17696749, 19256768, 23433810
Prostatic Hyperplasia	Associate	22180037, 27511358, 37781794
Prostatic Intraepithelial Neoplasia	Associate	10595928, 16446401, 37347938
Prostatic Intraepithelial Neoplasia	Inhibit	27594734
Prostatic Neoplasms	Associate	10779522, 11696442, 11748358, 12499435, 16235991, 16446401, 16803634, 17059341, 17067754, 17453001, 17965617, 18072598, 18076941, 18500686, 19229700, 19265530, 19470943, 19917083, 20860828, 21694441, 21822036, 21830905, 21839064, 21980513, 22052999, 22077694, 22180037, 22376260, 22672250, 22833520, 22859398, 23146971, 23874531, 24769028, 25251951, 25738352, 25753984, 26011342, 26086362, 26195723, 26447830, 27457352, 27511358, 27576364, 27594734, 28084441, 29660369, 30357756, 30373654, 30470249, 31115550, 31337649, 31666119, 32183092, 34581895, 35293017, 37347938, 37781794, 38493315, 7972132
Prostatic Neoplasms	Inhibit	18257117, 21622623, 25144624
Prostatic Neoplasms Castration Resistant	Associate	27883295, 29330943
Prostatitis	Associate	12937133, 15292941, 16323173, 16446401, 16803634, 17067754, 17597019, 22052999, 22077694, 22833520, 25216229, 26447830
Prostatitis	Inhibit	18500686, 7972132
Pulmonary Disease Chronic Obstructive	Associate	10413721, 14710442, 15218992, 20467983, 20525719, 21309732, 21734345, 22976395, 24670356, 27193053, 31564855, 34707353, 36808722
Pulmonary Edema	Associate	34883250
Pulmonary edema of mountaineers	Associate	28212552
Radiation Pneumonitis	Associate	28046029
Rectal Neoplasms	Associate	15770723, 20047135, 23894404
Recurrence	Stimulate	30765895
Respiratory Distress Syndrome	Associate	19183974
Respiratory Hypersensitivity	Associate	18057098
Respiratory Sounds	Associate	18335111, 19850963, 23357926, 24465030
Respiratory Tract Diseases	Associate	18335111, 33035787
Retinoblastoma	Associate	22278416
Rhinitis	Associate	27561723
Rhinitis Allergic	Associate	23663310
Salivary Gland Neoplasms	Associate	39201484
Sepsis	Associate	35681439
Severe Acute Malnutrition	Associate	16923217
Severe Acute Respiratory Syndrome	Associate	19635899
Signs and Symptoms Respiratory	Associate	16870661
Skin Diseases	Associate	16848913, 17284320, 39873985
Skin Neoplasms	Associate	11511301
Skin Ulcer	Associate	33280607
Smoke Inhalation Injury	Associate	18335111
Squamous Cell Carcinoma of Head and Neck	Associate	17179690, 19401526, 23523331, 25906090, 31249357, 32592358
Status Asthmaticus	Associate	14748821, 16870661, 17497028, 23600543
Stevens Johnson Syndrome	Associate	33035787
Stomach Diseases	Associate	28182092
Stomach Neoplasms	Associate	12695555, 12746473, 15831994, 15856451, 16309193, 17322540, 17646057, 20514304, 22517484, 23077566, 24453034, 25545243, 26768611, 28198496, 29434449, 33620602
Stomach Neoplasms	Stimulate	26768611
Thrombocytopenia	Associate	33326171
Thrombophilia	Associate	20592457
Thrombosis	Associate	35361071
Tonsillitis	Stimulate	30765895
Tourette Syndrome	Associate	24205873
Triple Negative Breast Neoplasms	Associate	25684485, 35729577
Tuberculosis Multidrug Resistant	Associate	22190510, 22310978, 27281183, 28581641, 9514046
Urinary Bladder Neoplasms	Associate	15780023, 18544563, 19443378, 22306368, 24040330, 24377535, 24919441, 26354850, 31646988
Urinary Bladder Neoplasms	Stimulate	15832776, 9164845
Urinary Bladder Neoplasms	Inhibit	24919441
Urologic Neoplasms	Associate	26158735
Uterine Cervical Neoplasms	Associate	12497653, 20069434, 29479986
Uterine Cervicitis	Associate	28829907
Vascular Diseases	Associate	31275451
Vestibular Diseases	Associate	18776599
Vomiting	Associate	28686330, 30870506, 31249357, 33280607
Weight Loss	Associate	34883250