Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2944
Gene name Gene Name - the full gene name approved by the HGNC.	Glutathione S-transferase mu 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GSTM1
Synonyms (NCBI Gene) Gene synonyms aliases	GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, MU, MU-1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omeg

Show/Hide all(123)

miRTarBase ID	miRNA	Experiments
MIRT1036556	hsa-miR-3689a-3p	CLIP-seq
MIRT1036557	hsa-miR-3689c	CLIP-seq
MIRT1036558	hsa-miR-4728-5p	CLIP-seq
MIRT1036559	hsa-miR-2909	CLIP-seq
MIRT1036560	hsa-miR-3126-5p	CLIP-seq
MIRT1036561	hsa-miR-4278	CLIP-seq
MIRT1036562	hsa-miR-4709-3p	CLIP-seq
MIRT1036563	hsa-miR-4716-3p	CLIP-seq
MIRT1036564	hsa-miR-4723-5p	CLIP-seq
MIRT1036565	hsa-miR-629	CLIP-seq
MIRT2007311	hsa-miR-2467-3p	CLIP-seq
MIRT2007312	hsa-miR-3678-3p	CLIP-seq
MIRT2007313	hsa-miR-4267	CLIP-seq
MIRT2007314	hsa-miR-4731-5p	CLIP-seq
MIRT2388804	hsa-miR-4508	CLIP-seq
MIRT2543552	hsa-miR-1252	CLIP-seq
MIRT2543553	hsa-miR-1264	CLIP-seq
MIRT2543554	hsa-miR-1302	CLIP-seq
MIRT2543555	hsa-miR-130a	CLIP-seq
MIRT2543556	hsa-miR-130b	CLIP-seq
MIRT2543557	hsa-miR-1909	CLIP-seq
MIRT2543558	hsa-miR-2467-5p	CLIP-seq
MIRT2543559	hsa-miR-2861	CLIP-seq
MIRT1036559	hsa-miR-2909	CLIP-seq
MIRT2543560	hsa-miR-301a	CLIP-seq
MIRT2543561	hsa-miR-301b	CLIP-seq
MIRT2543562	hsa-miR-3119	CLIP-seq
MIRT1036560	hsa-miR-3126-5p	CLIP-seq
MIRT2543563	hsa-miR-3132	CLIP-seq
MIRT2543564	hsa-miR-3155	CLIP-seq
MIRT2543565	hsa-miR-3155b	CLIP-seq
MIRT2543566	hsa-miR-3188	CLIP-seq
MIRT2543567	hsa-miR-3202	CLIP-seq
MIRT2543568	hsa-miR-3591-5p	CLIP-seq
MIRT2543569	hsa-miR-3666	CLIP-seq
MIRT1036556	hsa-miR-3689a-3p	CLIP-seq
MIRT1036557	hsa-miR-3689c	CLIP-seq
MIRT2543570	hsa-miR-3974	CLIP-seq
MIRT2543571	hsa-miR-3975	CLIP-seq
MIRT1036561	hsa-miR-4278	CLIP-seq
MIRT2543572	hsa-miR-4295	CLIP-seq
MIRT2543573	hsa-miR-4298	CLIP-seq
MIRT2543574	hsa-miR-4473	CLIP-seq
MIRT2543575	hsa-miR-4476	CLIP-seq
MIRT2543576	hsa-miR-4512	CLIP-seq
MIRT2543577	hsa-miR-4533	CLIP-seq
MIRT2543578	hsa-miR-454	CLIP-seq
MIRT2543579	hsa-miR-4649-3p	CLIP-seq
MIRT2543580	hsa-miR-4671-3p	CLIP-seq
MIRT1036562	hsa-miR-4709-3p	CLIP-seq
MIRT1036563	hsa-miR-4716-3p	CLIP-seq
MIRT1036564	hsa-miR-4723-5p	CLIP-seq
MIRT2543581	hsa-miR-4727-3p	CLIP-seq
MIRT1036558	hsa-miR-4728-5p	CLIP-seq
MIRT2543582	hsa-miR-4747-5p	CLIP-seq
MIRT2543583	hsa-miR-484	CLIP-seq
MIRT2543584	hsa-miR-485-5p	CLIP-seq
MIRT2543585	hsa-miR-493	CLIP-seq
MIRT1036565	hsa-miR-629	CLIP-seq
MIRT2543586	hsa-miR-635	CLIP-seq
MIRT2682141	hsa-miR-1224-3p	CLIP-seq
MIRT2543552	hsa-miR-1252	CLIP-seq
MIRT2682142	hsa-miR-1260	CLIP-seq
MIRT2682143	hsa-miR-1260b	CLIP-seq
MIRT2543553	hsa-miR-1264	CLIP-seq
MIRT2682144	hsa-miR-1280	CLIP-seq
MIRT2543554	hsa-miR-1302	CLIP-seq
MIRT2543555	hsa-miR-130a	CLIP-seq
MIRT2543556	hsa-miR-130b	CLIP-seq
MIRT2682145	hsa-miR-151-5p	CLIP-seq
MIRT2682146	hsa-miR-151b	CLIP-seq
MIRT2682147	hsa-miR-1827	CLIP-seq
MIRT2543557	hsa-miR-1909	CLIP-seq
MIRT2543558	hsa-miR-2467-5p	CLIP-seq
MIRT2543559	hsa-miR-2861	CLIP-seq
MIRT1036559	hsa-miR-2909	CLIP-seq
MIRT2543560	hsa-miR-301a	CLIP-seq
MIRT2543561	hsa-miR-301b	CLIP-seq
MIRT2543562	hsa-miR-3119	CLIP-seq
MIRT1036560	hsa-miR-3126-5p	CLIP-seq
MIRT2543563	hsa-miR-3132	CLIP-seq
MIRT2543564	hsa-miR-3155	CLIP-seq
MIRT2543565	hsa-miR-3155b	CLIP-seq
MIRT2682148	hsa-miR-3176	CLIP-seq
MIRT2543566	hsa-miR-3188	CLIP-seq
MIRT2543567	hsa-miR-3202	CLIP-seq
MIRT2543568	hsa-miR-3591-5p	CLIP-seq
MIRT2682149	hsa-miR-3612	CLIP-seq
MIRT2682150	hsa-miR-3665	CLIP-seq
MIRT2543569	hsa-miR-3666	CLIP-seq
MIRT1036556	hsa-miR-3689a-3p	CLIP-seq
MIRT1036557	hsa-miR-3689c	CLIP-seq
MIRT2682151	hsa-miR-3922-3p	CLIP-seq
MIRT2682152	hsa-miR-3922-5p	CLIP-seq
MIRT2543570	hsa-miR-3974	CLIP-seq
MIRT2543571	hsa-miR-3975	CLIP-seq
MIRT1036561	hsa-miR-4278	CLIP-seq
MIRT2543572	hsa-miR-4295	CLIP-seq
MIRT2543573	hsa-miR-4298	CLIP-seq
MIRT2543574	hsa-miR-4473	CLIP-seq
MIRT2543575	hsa-miR-4476	CLIP-seq
MIRT2543576	hsa-miR-4512	CLIP-seq
MIRT2543577	hsa-miR-4533	CLIP-seq
MIRT2543578	hsa-miR-454	CLIP-seq
MIRT2543579	hsa-miR-4649-3p	CLIP-seq
MIRT2543580	hsa-miR-4671-3p	CLIP-seq
MIRT2682153	hsa-miR-4695-5p	CLIP-seq
MIRT1036562	hsa-miR-4709-3p	CLIP-seq
MIRT1036563	hsa-miR-4716-3p	CLIP-seq
MIRT1036564	hsa-miR-4723-5p	CLIP-seq
MIRT2543581	hsa-miR-4727-3p	CLIP-seq
MIRT1036558	hsa-miR-4728-5p	CLIP-seq
MIRT2007314	hsa-miR-4731-5p	CLIP-seq
MIRT2682154	hsa-miR-4736	CLIP-seq
MIRT2543582	hsa-miR-4747-5p	CLIP-seq
MIRT2543583	hsa-miR-484	CLIP-seq
MIRT2543584	hsa-miR-485-5p	CLIP-seq
MIRT2543585	hsa-miR-493	CLIP-seq
MIRT1036565	hsa-miR-629	CLIP-seq
MIRT2543586	hsa-miR-635	CLIP-seq
MIRT2682155	hsa-miR-650	CLIP-seq
MIRT2682156	hsa-miR-764	CLIP-seq
MIRT2682157	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
MYB	Activation	14576818

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	8373352, 9084911
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004364	Function	Glutathione transferase activity	TAS	8403204
GO:0005737	Component	Cytoplasm	IDA	8373352
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IDA	9084911
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	8373352
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018916	Process	Nitrobenzene metabolic process	IDA	8373352
GO:0019899	Function	Enzyme binding	IPI	8373352
GO:0042178	Process	Xenobiotic catabolic process	IDA	8373352
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	8373352
GO:0043295	Function	Glutathione binding	IDA	8373352
GO:0051122	Process	Hepoxilin biosynthetic process	IDA	21046276
GO:0070458	Process	Cellular detoxification of nitrogen compound	IDA	8373352
GO:1901687	Process	Glutathione derivative biosynthetic process	IDA	9084911

MIM	HGNC	e!Ensembl
138350	4632	ENSG00000134184

Protein

UniProt ID

P09488

Protein name

Glutathione S-transferase Mu 1 (EC 2.5.1.18) (GST HB subunit 4) (GST class-mu 1) (GSTM1-1) (GSTM1a-1a) (GSTM1b-1b) (GTH4)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911). Particip

PDB

1GTU , 1XW6 , 1XWK , 1YJ6 , 2F3M , 7BEU , 8VOU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	3 → 82	Glutathione S-transferase, N-terminal domain	Domain
PF14497	GST_C_3	105 → 201	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Liver (at protein level). {ECO:0000269|PubMed:7822249}.

Sequence

MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK

Sequence length

218

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Glutathione conjugation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (243)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Chest Syndrome	Associate	25880856
Adenocarcinoma	Associate	8200549
Adenocarcinoma of Lung	Associate	12824892
Adenoma	Associate	18093316
Age Related Hearing Impairment 1	Associate	17513527
AIDS Associated Nephropathy	Associate	29795558
AIDS Related Complex	Stimulate	22665971
Alcoholism	Associate	26937962
Alzheimer Disease	Associate	25542503
Anemia Aplastic	Associate	11719393
Anemia Hemolytic	Associate	16173971
Anemia Sickle Cell	Associate	25880856, 27885941
Anxiety	Associate	22661588
Arsenic Poisoning	Associate	31864032
Arterial Occlusive Diseases	Associate	25880856
Arthritis Juvenile	Associate	11920399
Arthritis Rheumatoid	Associate	11920399, 16887863, 21087494, 21445357, 28703442
Asthma	Associate	15223862, 17497028, 18988661, 19860819, 20526719, 21051083, 22228263, 24186968, 25328891, 31059917, 35186174
Asthma Exercise Induced	Associate	22610343
Atherosclerosis	Associate	22363809, 28362975
Autism Spectrum Disorder	Inhibit	30824761
Autism Spectrum Disorder	Associate	35741737
Autistic Disorder	Associate	16472391
Balkan Nephropathy	Associate	27568660
beta Thalassemia	Associate	26288192
Biliary Atresia	Associate	36181129
Birth Weight	Associate	19440446
Bone Marrow Failure Disorders	Associate	16173971
Brain Damage Chronic	Associate	8923609
Brain Neoplasms	Associate	23661361
Breast Neoplasms	Associate	11056682, 14562023, 17416769, 17624589, 17683074, 17696741, 18425393, 18542066, 19287511, 19469640, 20568049, 21557334, 22564471, 22782090, 23244102 View all (15 more)
Bronchial Diseases	Associate	24613990
Cancer Familial with In Vitro Radioresistance	Associate	25010410
Carcinogenesis	Associate	17203516, 18596959, 26295053, 26434855, 34269240
Carcinoma Basal Cell	Associate	16582078, 9077484
Carcinoma Basal Cell	Stimulate	17505575
Carcinoma Basal Cell	Inhibit	8554981
Carcinoma Hepatocellular	Associate	15633230, 20683151, 22994742, 29582627, 7892276, 8659516
Carcinoma Intraductal Noninfiltrating	Associate	11056682
Carcinoma Non Small Cell Lung	Associate	20529827, 27090234, 27706763
Carcinoma Ovarian Epithelial	Associate	22960333, 8956789
Carcinoma Renal Cell	Associate	14504370, 18566013
Carcinoma Renal Cell	Stimulate	27500405
Carcinoma Small Cell	Associate	25472599
Carcinoma Squamous Cell	Associate	11511301, 21870186, 9231161
Carcinoma Squamous Cell	Stimulate	22169897, 25663492
Carcinoma Transitional Cell	Associate	23394311
Cardiomyopathy Dilated	Associate	34871528
Cardiovascular Diseases	Associate	24423050, 33574979
Cataract	Associate	16551760, 22665971, 22876127
Cataract Age Related Nuclear	Associate	25923095
Cataract posterior polar 1	Stimulate	22665971
Cholestasis	Inhibit	25798860
Chronic Kidney Disease Mineral and Bone Disorder	Associate	26940095
Chronic Periodontitis	Associate	36833382
Cognition Disorders	Associate	18952980, 21734345
Colonic Neoplasms	Associate	32539715
Colorectal Neoplasms	Associate	10901185, 18093316, 18473390, 18630481, 19443391, 20937634, 22126490, 23790786, 23886179, 25249451, 25408579, 26406947, 26909940, 30106268, 35674599
Colorectal Neoplasms	Stimulate	20937634, 30356976, 30694518
Colorectal Neoplasms	Inhibit	31740522
Coronary Artery Disease	Associate	16620396, 18583868, 28362975
COVID 19	Associate	33990973
Cystic Fibrosis	Associate	10195071, 20140303, 23758905, 24593045
Death	Associate	22799358, 22994742, 24040330, 37798436
Death	Stimulate	23244102, 26571237
Death	Inhibit	27173276, 27706763
Depressive Disorder	Associate	22661588
Dermatitis Atopic	Associate	26580648, 30650146
Diabetes Gestational	Associate	26823865, 27323114
Diabetes Mellitus	Associate	20954980, 22058002, 22086798, 22732554, 36676788
Diabetes Mellitus Type 1	Associate	16390810, 19752172, 24053064, 27908841
Diabetes Mellitus Type 2	Associate	22058002, 22377702, 24098457
Diabetes Mellitus Type 2	Stimulate	36834424
Diabetic Retinopathy	Associate	19752172
Diabetic Retinopathy	Inhibit	22377702
Disease	Associate	18334963
Drug Related Side Effects and Adverse Reactions	Associate	20074657, 23481061, 23684483, 25928802, 36316809, 36952646
Dyspnea	Associate	15223862, 16870661
Emphysema	Associate	21734345
Endometriosis	Associate	11730751, 12620480, 19535834, 20504102, 25549292, 27323100, 34384077, 36013572
Environmental Illness	Associate	14562023
Epilepsy	Associate	12499585, 18644106
Epilepsy Tonic Clonic	Associate	30095041
Esophageal Neoplasms	Associate	15968714, 17203516, 23749488, 26782562
Esophageal Squamous Cell Carcinoma	Associate	25432134, 26004606
Essential Hypertension	Associate	25357227, 32188413, 34193266, 35132887
Exfoliation Syndrome	Associate	18334963, 21151336
Gallbladder Neoplasms	Associate	26925680
Gastritis	Associate	15112335
Gastrointestinal Neoplasms	Associate	19960570
Glaucoma	Associate	16973661, 18334963, 25366778
Glaucoma Angle Closure	Associate	18334963, 25725180
Glaucoma Open Angle	Stimulate	16973661
Glaucoma Open Angle	Associate	18334963, 21738397, 23079819, 25366778
Glioblastoma	Associate	34732244
Graft vs Host Disease	Associate	26103006
Head and Neck Neoplasms	Associate	20676536, 21133595, 21545198, 36037119
Hearing Disorders	Associate	32435918
Hearing Loss	Associate	18162130
Hearing Loss Noise Induced	Associate	20812880
Hearing Loss Noise Induced	Stimulate	39476807
Heart Defects Congenital	Associate	26456689
Heart Diseases	Associate	30095041, 34193266
Helicobacter Infections	Associate	16270381
Hematologic Diseases	Associate	29204680
Hematologic Neoplasms	Associate	34499222
Hemolytic Uremic Syndrome	Associate	33574979
Hemorrhage	Associate	36952646
Hepatic Veno Occlusive Disease	Associate	23287989, 26729828
Hepatic venoocclusive disease with immunodeficiency	Associate	15142875
Hepatitis Autoimmune	Associate	39863504
Hepatitis B	Associate	7892276
Hepatitis B Chronic	Associate	8659516
Hereditary Angioedema Type III	Associate	27964748
Hodgkin Disease	Associate	15368334
Hyperbilirubinemia Neonatal	Associate	24186968, 28069791
Hypertension	Associate	22108414, 25357227, 32188413, 35132887
Hypertension Pulmonary	Associate	25880856
Hypertensive Retinopathy	Associate	22377702
Hypertriglyceridemia	Associate	19419718
Immunologic Deficiency Syndromes	Inhibit	20504102
Infertility	Associate	34384077, 34871528
Infertility Male	Associate	22903474, 25532576, 33786731, 34806654
Inflammation	Associate	18596959, 19796798, 33574979, 36703205, 9008240
Inflammatory Bowel Diseases	Associate	30987408
Iron Deficiencies	Associate	19384939
Iron Overload	Associate	26288192
Keratosis	Associate	12485442
Kidney Failure Chronic	Associate	18067039, 24423050, 26940095, 27498857, 33574979
Laryngeal Neoplasms	Associate	14594555
Leiomyoma	Associate	18829006, 24324590
Leprosy	Associate	23077626
Leukemia Lymphocytic Chronic B Cell	Associate	12010828, 18061941, 18224491, 32102530
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	16235982, 30995900, 35527244
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	31111691
Leukemia Myeloid Acute	Associate	12351375, 12827651, 16493615, 23725116, 23886197, 24854448, 26960454, 36316809
Leukemia Myeloid Acute	Inhibit	25799091
Leukemia Promyelocytic Acute	Associate	21875282
Leukoplakia	Associate	19634112
Leukoplakia Oral	Associate	18507060, 19634112, 27723629, 34269240
Liver Cirrhosis Biliary	Associate	8491405
Liver Diseases Alcoholic	Stimulate	26937962
Liver Diseases Alcoholic	Associate	29582627
Liver Failure	Associate	24465778, 29582627
Lung Diseases	Associate	21734345, 7974294
Lung Neoplasms	Associate	10901185, 16788248, 18281920, 19174490, 19394866, 19567511, 20156772, 20501762, 21122939, 21206385, 22392686, 22888806, 23803127, 24222509, 24460270 View all (9 more)
Lung Neoplasms	Inhibit	24852519
Lupus Erythematosus Systemic	Stimulate	17195228
Lymphedema	Associate	36181129
Lymphoma Large B Cell Diffuse	Associate	28039708
Lymphoma Non Hodgkin	Associate	12139735, 18061941
Lymphoma T Cell Cutaneous	Associate	31358475
Macular Degeneration	Inhibit	22410570
Macular Degeneration	Associate	25897651
Malaria Falciparum	Inhibit	19635899
Medulloblastoma	Associate	18952980, 22661588
Melanoma	Associate	19161404, 21461548, 7640212
Melanoma Cutaneous Malignant	Associate	21461548
Mitochondrial Diseases	Associate	21694442
Mouth Diseases	Associate	22660220, 28182092
Mouth Neoplasms	Associate	17461521, 19729828, 21545219, 22660220, 23681307, 25735346, 29037125, 30539845, 34269240, 35390586, 35751315
Mucositis	Associate	20074657, 28182092
Myelodysplastic Syndromes	Stimulate	23684483
Myoclonic Epilepsies Progressive	Associate	26552558
Nasopharyngeal Carcinoma	Associate	16235985, 18628429, 18712965, 19448408
Nasopharyngeal Neoplasms	Associate	22393996
Neoplasms	Associate	11056682, 12718704, 12747973, 14562023, 14594555, 1486839, 15968714, 16235985, 16611538, 17624589, 19252342, 19443391, 19729828, 20529827, 21089003 View all (21 more)
Neoplasms	Stimulate	26158735
Neoplasms Second Primary	Associate	16703596, 19401526
Neoplasms Squamous Cell	Associate	15968714, 17203516, 22072123
Neutropenia	Associate	20530282
Niemann Pick Disease Type C	Associate	22393996
Non Muscle Invasive Bladder Neoplasms	Associate	21286014, 24040330
Obesity	Associate	16020798, 19057702
Osteoporosis	Associate	22048269, 35602340
Osteosarcoma	Associate	22471480
Ototoxicity	Associate	28182092
Ovarian Diseases	Associate	34384077
Ovarian Neoplasms	Associate	11328408, 18768514
Pain	Associate	36939926
Pancreatic Neoplasms	Associate	22301281
Papillomavirus Infections	Associate	23469236, 25281494, 35507115
Parkinson Disease	Associate	17194543, 17449559, 23982010, 32359946
Peripheral Nervous System Diseases	Associate	18952980, 36939926
Pituitary Neoplasms	Associate	30321868
Pleural Diseases	Associate	20847076
Polycystic Ovary Syndrome	Associate	29952411, 33124502
Porphyria Cutanea Tarda	Associate	20957336
Precancerous Conditions	Associate	18628429, 21586620
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10050715, 19256768, 20067466, 36952646
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22924777
Presbycusis	Associate	20647132
Prostatic Hyperplasia	Associate	19407363, 20843117, 21089003, 21133626, 21694442
Prostatic Neoplasms	Associate	15472409, 15899813, 16625286, 17059341, 19568698, 21089003, 21694442, 22564066, 25198353, 30362312, 35293017
Prostatic Neoplasms	Inhibit	21705483
Prostatitis	Associate	15472409, 18094897, 18596959
Psoriasis	Associate	12713578
Pterygium	Associate	15273656, 20596254, 20700368, 26125818
Pulmonary Disease Chronic Obstructive	Associate	15218992, 19860819, 21309732, 21513434, 21734345, 24506742, 27421065, 28949773, 28951769, 34707353, 36698131
Pulmonary Disease Chronic Obstructive	Stimulate	18461673
Pulmonary Disease Chronic Obstructive	Inhibit	24809844
Pyruvate Carboxylase Deficiency Disease	Stimulate	36824501
Renal Insufficiency Chronic	Associate	20954980, 34871703
Renal Insufficiency Chronic	Stimulate	27975059
Respiration Disorders	Associate	19796798
Respiratory Sounds	Associate	15223862, 21051083
Retinal Dysplasia	Associate	27723629
Seizures	Associate	12499585
Signs and Symptoms Respiratory	Associate	16870661
Sjogren's Syndrome	Associate	10616008, 24574234
Skin Hair Eye Pigmentation Variation In 4	Associate	12485442
Skin Neoplasms	Associate	8554981
Smoke Inhalation Injury	Associate	12718704, 17683074, 34452561
smoker's inclusion bodies	Associate	24637631
Squamous Cell Carcinoma of Head and Neck	Associate	17461521, 19401526, 19442564, 21870186, 22660220, 23681307, 27723629, 31244319, 9659241
Squamous Cell Carcinoma of Head and Neck	Inhibit	35390586
Squamous Intraepithelial Lesions	Associate	24815471
Status Asthmaticus	Associate	16870661, 20367187, 23379631
Stomach Diseases	Associate	28182092
Stomach Neoplasms	Associate	15856451, 16270381, 19610060, 20878561, 22799358, 30726307, 36109518
Stomach Neoplasms	Inhibit	22471491
Stomach Neoplasms	Stimulate	22994755
Stroke	Associate	24423050
Sunburn	Associate	19161404, 21461548
Temporomandibular Joint Disorders	Associate	21615938
Thyroid Cancer Papillary	Associate	18601742
Thyroid Diseases	Associate	21086258
Thyroid Neoplasms	Associate	15368334
Thyroid Nodule	Associate	21086258
Tuberculosis	Associate	31697922
Upton Young syndrome	Associate	7640212
Urinary Bladder Diseases	Associate	18094897
Urinary Bladder Neoplasms	Associate	10783912, 15832776, 17026750, 17496311, 19692168, 21286014, 22817656, 23284801, 23394311, 23886208, 24040330, 24240585, 24914957, 24919441, 26374428 View all (6 more)
Urinary Bladder Neoplasms	Inhibit	17381051, 18544563, 20732908
Urologic Neoplasms	Associate	26158735
Urticaria Solar	Associate	12485442
Uterine Cervical Diseases	Associate	24815471, 25663492
Uterine Cervical Dysplasia	Associate	20130515
Uterine Cervical Neoplasms	Associate	25281494, 26571237, 28361858
Uterine Cervicitis	Associate	24815471
Ventricular Dysfunction Left	Associate	30095041
Virus Diseases	Associate	35507115
Vitiligo	Associate	19571817, 29641697

GSTM1 (glutathione S-transferase mu 1)