Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2938
Gene name Gene Name - the full gene name approved by the HGNC.	Glutathione S-transferase alpha 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GSTA1
Synonyms (NCBI Gene) Gene synonyms aliases	GST-epsilon, GST2, GSTA1-1, GTH1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p12.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a family of enzymes that function to add glutathione to target electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. This action is an important step in det

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029138	hsa-miR-26b-5p	Microarray	19088304
MIRT1036467	hsa-miR-4269	CLIP-seq
MIRT1036468	hsa-miR-4757-5p	CLIP-seq
MIRT1036469	hsa-miR-488	CLIP-seq
MIRT1036470	hsa-miR-513b	CLIP-seq
MIRT2007285	hsa-miR-23a	CLIP-seq
MIRT2007286	hsa-miR-23b	CLIP-seq
MIRT2007287	hsa-miR-23c	CLIP-seq
MIRT2007288	hsa-miR-3148	CLIP-seq
MIRT2007289	hsa-miR-3978	CLIP-seq
MIRT2007290	hsa-miR-432	CLIP-seq
MIRT2007291	hsa-miR-4427	CLIP-seq
MIRT2007292	hsa-miR-4452	CLIP-seq
MIRT2007293	hsa-miR-4680-3p	CLIP-seq
MIRT2239913	hsa-miR-519a	CLIP-seq
MIRT2239914	hsa-miR-519b-3p	CLIP-seq
MIRT2239915	hsa-miR-519c-3p	CLIP-seq
MIRT2007293	hsa-miR-4680-3p	CLIP-seq
MIRT2543451	hsa-miR-4724-5p	CLIP-seq
MIRT2007293	hsa-miR-4680-3p	CLIP-seq
MIRT2543451	hsa-miR-4724-5p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFE2L2	Activation	16551619
NFE2L2	Repression	22459801

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	9084911, 11851347, 20606271
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004364	Function	Glutathione transferase activity	NAS	1731620
GO:0004601	Function	Peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IDA	16624487
GO:0004769	Function	Steroid Delta-isomerase activity	IDA	11152686
GO:0005504	Function	Fatty acid binding	IPI	16624487
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IDA	9084911
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	11851347
GO:0006749	Process	Glutathione metabolic process	IDA	20606271
GO:0006805	Process	Xenobiotic metabolic process	IBA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0043651	Process	Linoleic acid metabolic process	IDA	16624487
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1901687	Process	Glutathione derivative biosynthetic process	IDA	9084911

MIM	HGNC	e!Ensembl
138359	4626	ENSG00000243955

Protein

UniProt ID

P08263

Protein name

Glutathione S-transferase A1 (EC 2.5.1.18) (13-hydroperoxyoctadecadienoate peroxidase) (EC 1.11.1.-) (Androst-5-ene-3,17-dione isomerase) (EC 5.3.3.-) (GST HA subunit 1) (GST class-alpha member 1) (GST-epsilon) (GSTA1-1) (GTH1) [Cleaved into: Glutathione

Protein function

Glutathione S-transferase that catalyzes the nucleophilic attack of the sulfur atom of glutathione on the electrophilic groups of a wide range of exogenous and endogenous compounds (Probable). Involved in the formation of glutathione conjugates

PDB

1GSD , 1GSE , 1GSF , 1GUH , 1K3L , 1K3O , 1K3Y , 1LBK , 1PKW , 1PKZ , 1PL1 , 1PL2 , 1USB , 1XWG , 1YDK , 2R3X , 2R6K , 3I69 , 3I6A , 3IK9 , 3KTL , 3L0H , 3Q74 , 3U6V , 3ZFB , 3ZFL , 4HJ2 , 5JCU , 5LCZ , 5LD0 , 6ATO , 6ATP , 6ATQ , 6ATR , 6YAW , 7BIB , 7BIC , 8BHC , 8BHE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	5 → 77	Glutathione S-transferase, N-terminal domain	Domain
PF00043	GST_C	99 → 192	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Liver.

Sequence

MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF

Sequence length

222

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Glutathione conjugation Heme degradation

GSTA1 (glutathione S-transferase alpha 1)