Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2934
Gene name	Gelsolin
Gene symbol	GSN
Synonyms (NCBI Gene)	ADFAGELAMYLD4
Chromosome	9
Chromosome location	9q33.2
Summary	The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121909715	G>A,T	Pathogenic	Non coding transcript variant, genic upstream transcript variant, 5 prime UTR variant, coding sequence variant, upstream transcript variant, missense variant
rs1554821138	C>-	Likely-pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant

138

Show/Hide all (138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002639	hsa-miR-124-3p	Microarray	15685193
MIRT018068	hsa-miR-335-5p	Microarray	18185580
MIRT002639	hsa-miR-124-3p	Microarray	18668037
MIRT002639	hsa-miR-124-3p	Microarray	15685193
MIRT629489	hsa-miR-8485	HITS-CLIP	23313552
MIRT629488	hsa-miR-603	HITS-CLIP	23313552
MIRT629487	hsa-miR-103b	HITS-CLIP	23313552
MIRT002639	hsa-miR-124-3p	HITS-CLIP	23313552
MIRT688021	hsa-miR-548an	HITS-CLIP	23313552
MIRT688020	hsa-miR-8080	HITS-CLIP	23313552
MIRT688019	hsa-miR-9500	HITS-CLIP	23313552
MIRT688018	hsa-miR-584-3p	HITS-CLIP	23313552
MIRT688017	hsa-miR-3126-5p	HITS-CLIP	23313552
MIRT688016	hsa-miR-6875-5p	HITS-CLIP	23313552
MIRT688015	hsa-miR-4419a	HITS-CLIP	23313552
MIRT688014	hsa-miR-4510	HITS-CLIP	23313552
MIRT688013	hsa-miR-6127	HITS-CLIP	23313552
MIRT688012	hsa-miR-6129	HITS-CLIP	23313552
MIRT688011	hsa-miR-6130	HITS-CLIP	23313552
MIRT688010	hsa-miR-6133	HITS-CLIP	23313552
MIRT688009	hsa-miR-4533	HITS-CLIP	23313552
MIRT688008	hsa-miR-4747-5p	HITS-CLIP	23313552
MIRT688007	hsa-miR-5196-5p	HITS-CLIP	23313552
MIRT688006	hsa-miR-6834-5p	HITS-CLIP	23313552
MIRT688005	hsa-miR-1226-5p	HITS-CLIP	23313552
MIRT688004	hsa-miR-6734-5p	HITS-CLIP	23313552
MIRT688003	hsa-miR-1304-5p	HITS-CLIP	23313552
MIRT629489	hsa-miR-8485	HITS-CLIP	23824327
MIRT629488	hsa-miR-603	HITS-CLIP	23824327
MIRT629487	hsa-miR-103b	HITS-CLIP	23824327
MIRT629486	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT629485	hsa-miR-767-3p	HITS-CLIP	23824327
MIRT629484	hsa-miR-558	HITS-CLIP	23824327
MIRT629483	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT629482	hsa-miR-6828-3p	HITS-CLIP	23824327
MIRT629481	hsa-miR-5691	HITS-CLIP	23824327
MIRT629480	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT737455	hsa-miR-141-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)RNA-seqqRT-PCR	31996784
MIRT629489	hsa-miR-8485	HITS-CLIP	23313552
MIRT629488	hsa-miR-603	HITS-CLIP	23313552
MIRT629487	hsa-miR-103b	HITS-CLIP	23313552
MIRT002639	hsa-miR-124-3p	HITS-CLIP	23313552
MIRT688021	hsa-miR-548an	HITS-CLIP	23313552
MIRT688020	hsa-miR-8080	HITS-CLIP	23313552
MIRT688019	hsa-miR-9500	HITS-CLIP	23313552
MIRT688018	hsa-miR-584-3p	HITS-CLIP	23313552
MIRT688017	hsa-miR-3126-5p	HITS-CLIP	23313552
MIRT688016	hsa-miR-6875-5p	HITS-CLIP	23313552
MIRT688015	hsa-miR-4419a	HITS-CLIP	23313552
MIRT688014	hsa-miR-4510	HITS-CLIP	23313552
MIRT688013	hsa-miR-6127	HITS-CLIP	23313552
MIRT688012	hsa-miR-6129	HITS-CLIP	23313552
MIRT688011	hsa-miR-6130	HITS-CLIP	23313552
MIRT688010	hsa-miR-6133	HITS-CLIP	23313552
MIRT688009	hsa-miR-4533	HITS-CLIP	23313552
MIRT688008	hsa-miR-4747-5p	HITS-CLIP	23313552
MIRT688007	hsa-miR-5196-5p	HITS-CLIP	23313552
MIRT688006	hsa-miR-6834-5p	HITS-CLIP	23313552
MIRT688005	hsa-miR-1226-5p	HITS-CLIP	23313552
MIRT688004	hsa-miR-6734-5p	HITS-CLIP	23313552
MIRT688003	hsa-miR-1304-5p	HITS-CLIP	23313552
MIRT629489	hsa-miR-8485	HITS-CLIP	23824327
MIRT629488	hsa-miR-603	HITS-CLIP	23824327
MIRT629487	hsa-miR-103b	HITS-CLIP	23824327
MIRT629486	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT629485	hsa-miR-767-3p	HITS-CLIP	23824327
MIRT629484	hsa-miR-558	HITS-CLIP	23824327
MIRT629483	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT629482	hsa-miR-6828-3p	HITS-CLIP	23824327
MIRT629481	hsa-miR-5691	HITS-CLIP	23824327
MIRT629480	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT1036115	hsa-miR-1183	CLIP-seq
MIRT1036116	hsa-miR-124	CLIP-seq
MIRT1036117	hsa-miR-1261	CLIP-seq
MIRT1036118	hsa-miR-129-5p	CLIP-seq
MIRT1036119	hsa-miR-1304	CLIP-seq
MIRT1036120	hsa-miR-1909	CLIP-seq
MIRT1036121	hsa-miR-3607-3p	CLIP-seq
MIRT1036122	hsa-miR-4427	CLIP-seq
MIRT1036123	hsa-miR-450b-5p	CLIP-seq
MIRT1036124	hsa-miR-4521	CLIP-seq
MIRT1036125	hsa-miR-4522	CLIP-seq
MIRT1036126	hsa-miR-4680-3p	CLIP-seq
MIRT1036127	hsa-miR-4708-3p	CLIP-seq
MIRT1036128	hsa-miR-4714-5p	CLIP-seq
MIRT1036129	hsa-miR-4753-5p	CLIP-seq
MIRT1036130	hsa-miR-4757-5p	CLIP-seq
MIRT1036131	hsa-miR-506	CLIP-seq
MIRT1036132	hsa-miR-507	CLIP-seq
MIRT1036133	hsa-miR-557	CLIP-seq
MIRT1036118	hsa-miR-129-5p	CLIP-seq
MIRT2007213	hsa-miR-141	CLIP-seq
MIRT1036120	hsa-miR-1909	CLIP-seq
MIRT2007214	hsa-miR-200a	CLIP-seq
MIRT1036122	hsa-miR-4427	CLIP-seq
MIRT1036123	hsa-miR-450b-5p	CLIP-seq
MIRT1036125	hsa-miR-4522	CLIP-seq
MIRT1036126	hsa-miR-4680-3p	CLIP-seq
MIRT1036127	hsa-miR-4708-3p	CLIP-seq
MIRT1036128	hsa-miR-4714-5p	CLIP-seq
MIRT1036132	hsa-miR-507	CLIP-seq
MIRT1036133	hsa-miR-557	CLIP-seq
MIRT1036118	hsa-miR-129-5p	CLIP-seq
MIRT2007213	hsa-miR-141	CLIP-seq
MIRT1036120	hsa-miR-1909	CLIP-seq
MIRT2007214	hsa-miR-200a	CLIP-seq
MIRT1036122	hsa-miR-4427	CLIP-seq
MIRT1036123	hsa-miR-450b-5p	CLIP-seq
MIRT1036125	hsa-miR-4522	CLIP-seq
MIRT1036126	hsa-miR-4680-3p	CLIP-seq
MIRT1036127	hsa-miR-4708-3p	CLIP-seq
MIRT1036128	hsa-miR-4714-5p	CLIP-seq
MIRT2239780	hsa-miR-4775	CLIP-seq
MIRT1036132	hsa-miR-507	CLIP-seq
MIRT1036133	hsa-miR-557	CLIP-seq
MIRT1036118	hsa-miR-129-5p	CLIP-seq
MIRT1036120	hsa-miR-1909	CLIP-seq
MIRT1036122	hsa-miR-4427	CLIP-seq
MIRT1036123	hsa-miR-450b-5p	CLIP-seq
MIRT1036125	hsa-miR-4522	CLIP-seq
MIRT1036126	hsa-miR-4680-3p	CLIP-seq
MIRT1036127	hsa-miR-4708-3p	CLIP-seq
MIRT1036128	hsa-miR-4714-5p	CLIP-seq
MIRT1036132	hsa-miR-507	CLIP-seq
MIRT1036133	hsa-miR-557	CLIP-seq
MIRT1036115	hsa-miR-1183	CLIP-seq
MIRT1036117	hsa-miR-1261	CLIP-seq
MIRT1036118	hsa-miR-129-5p	CLIP-seq
MIRT1036120	hsa-miR-1909	CLIP-seq
MIRT1036121	hsa-miR-3607-3p	CLIP-seq
MIRT1036122	hsa-miR-4427	CLIP-seq
MIRT1036123	hsa-miR-450b-5p	CLIP-seq
MIRT1036125	hsa-miR-4522	CLIP-seq
MIRT1036126	hsa-miR-4680-3p	CLIP-seq
MIRT1036127	hsa-miR-4708-3p	CLIP-seq
MIRT1036128	hsa-miR-4714-5p	CLIP-seq
MIRT1036132	hsa-miR-507	CLIP-seq
MIRT1036133	hsa-miR-557	CLIP-seq

Show/Hide all (91)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002102	Component	Podosome	IDA
GO:0003779	Function	Actin binding	IDA	18266911
GO:0003779	Function	Actin binding	IEA
GO:0005509	Function	Calcium ion binding	IMP	14596804
GO:0005509	Function	Calcium ion binding	TAS	1321812
GO:0005515	Function	Protein binding	IPI	10793131, 16531231, 17470807, 17620599, 18689676, 19015515, 19574450, 19666512, 23325791, 29961565, 32814053
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IBA
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IDA	3020431
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	14596804, 19549824, 22952982
GO:0005634	Component	Nucleus	IDA	23729654
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23575248
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	3020431
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	23575248
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IEA
GO:0006911	Process	Phagocytosis, engulfment	IEA
GO:0006911	Process	Phagocytosis, engulfment	ISS
GO:0007015	Process	Actin filament organization	IGI	23575248
GO:0007417	Process	Central nervous system development	IBA
GO:0008154	Process	Actin polymerization or depolymerization	IBA
GO:0010628	Process	Positive regulation of gene expression	IMP	22952982
GO:0014891	Process	Striated muscle atrophy	IMP	19549824
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0015629	Component	Actin cytoskeleton	TAS	1321812
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016528	Component	Sarcoplasm	IDA	19549824
GO:0022617	Process	Extracellular matrix disassembly	IMP
GO:0030027	Component	Lamellipodium	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030031	Process	Cell projection assembly	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030041	Process	Actin filament polymerization	IDA	3020431
GO:0030041	Process	Actin filament polymerization	IEA
GO:0030041	Process	Actin filament polymerization	IMP	23729654
GO:0030042	Process	Actin filament depolymerization	IDA	30568254
GO:0030042	Process	Actin filament depolymerization	IEA
GO:0030478	Component	Actin cap	IDA	23575248
GO:0030864	Component	Cortical actin cytoskeleton	IDA	23575248
GO:0030864	Component	Cortical actin cytoskeleton	IDA
GO:0031648	Process	Protein destabilization	IMP	19549824
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035994	Process	Response to muscle stretch	IEA
GO:0035994	Process	Response to muscle stretch	ISS	30568254
GO:0036313	Function	Phosphatidylinositol 3-kinase catalytic subunit binding	IEA
GO:0036313	Function	Phosphatidylinositol 3-kinase catalytic subunit binding	IPI	30568254
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045159	Function	Myosin II binding	IPI	23325791
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IMP	23575248
GO:0046872	Function	Metal ion binding	IEA
GO:0051014	Process	Actin filament severing	IBA
GO:0051014	Process	Actin filament severing	IDA	3020431
GO:0051014	Process	Actin filament severing	IEA
GO:0051014	Process	Actin filament severing	IMP	23575248
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IEA
GO:0051016	Process	Barbed-end actin filament capping	IBA
GO:0051016	Process	Barbed-end actin filament capping	TAS	1321812
GO:0051127	Process	Positive regulation of actin nucleation	IEA
GO:0051127	Process	Positive regulation of actin nucleation	IMP	19666531
GO:0051693	Process	Actin filament capping	IEA
GO:0051693	Process	Actin filament capping	IMP	19666531
GO:0051693	Process	Actin filament capping	ISS
GO:0055119	Process	Relaxation of cardiac muscle	IEA
GO:0055119	Process	Relaxation of cardiac muscle	ISS	30568254
GO:0060271	Process	Cilium assembly	IMP	20393563
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 21362503, 23533145
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071801	Process	Regulation of podosome assembly	IMP
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0086003	Process	Cardiac muscle cell contraction	IEA
GO:0086003	Process	Cardiac muscle cell contraction	ISS	30568254
GO:0097017	Process	Renal protein absorption	IMP	24601799
GO:0097284	Process	Hepatocyte apoptotic process	IMP	22952982
GO:1902174	Process	Positive regulation of keratinocyte apoptotic process	IMP	23729654
GO:1903903	Process	Regulation of establishment of T cell polarity	IMP	23575248
GO:1903906	Process	Regulation of plasma membrane raft polarization	IMP	23575248
GO:1903909	Process	Regulation of receptor clustering	IMP	23575248
GO:1903923	Process	Positive regulation of protein processing in phagocytic vesicle	IEA
GO:1903923	Process	Positive regulation of protein processing in phagocytic vesicle	ISS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1990000	Process	Amyloid fibril formation	IMP	19904968, 24601799

MIM	HGNC	e!Ensembl
137350	4620	ENSG00000148180

P06396

Protein name

Gelsolin (AGEL) (Actin-depolymerizing factor) (ADF) (Brevin)

Protein function

Calcium-regulated, actin-modulating protein that binds to the plus (or barbed) ends of actin monomers or filaments, preventing monomer exchange (end-blocking or capping). It can promote the assembly of monomers into filaments (nucleation) as wel

PDB

1C0F , 1C0G , 1D4X , 1DEJ , 1EQY , 1ESV , 1H1V , 1KCQ , 1MDU , 1NLV , 1NM1 , 1NMD , 1P8X , 1P8Z , 1SOL , 1T44 , 1YAG , 1YVN , 2FF3 , 2FF6 , 2FH1 , 2FH2 , 2FH3 , 2FH4 , 3A5L , 3A5M , 3A5N , 3A5O , 3CI5 , 3CIP , 3CJB , 3CJC , 3FFK , 3FFN , 3TU5 , 4PKG , 4PKH , 4PKI , 4S10 , 4Z94 , 5FAE , 5FAF , 5H3M , 5H3N , 5O2Z , 5UBO , 5ZZ0 , 6H1F , 6JCO , 6JEG , 6JEH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00626	Gelsolin	75 → 158	Gelsolin repeat	Domain
PF00626	Gelsolin	196 → 271	Gelsolin repeat	Domain
PF00626	Gelsolin	313 → 390	Gelsolin repeat	Domain
PF00626	Gelsolin	454 → 536	Gelsolin repeat	Domain
PF00626	Gelsolin	574 → 642	Gelsolin repeat	Domain
PF00626	Gelsolin	679 → 757	Gelsolin repeat	Domain

Tissue specificity

TISSUE SPECIFICITY: Phagocytic cells, platelets, fibroblasts, nonmuscle cells, smooth and skeletal muscle cells.

Sequence

MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFL
KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNEC
SQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVV
PNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKA
TQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL
YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALK
TASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY
RHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFG
GKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS
AAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDK
KMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEK
TEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAEL
AA

Sequence length

782

Interactions

View interactions

	KEGG		Reactome
	Fc gamma R-mediated phagocytosis Regulation of actin cytoskeleton Viral carcinogenesis		Caspase-mediated cleavage of cytoskeletal proteins Neutrophil degranulation Amyloid fiber formation

304

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Finnish type amyloidosis	Pathogenic; Likely pathogenic	rs2133433678, rs1564564688, rs2059635206, rs121909715	RCV005042601 RCV003138161 RCV003158015 RCV000017564 RCV000017565

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs2304393	RCV005900487
Adrenocortical carcinoma, hereditary	Benign	rs2304393	RCV005900488
Amyloidosis	Uncertain significance; Benign	rs745588757, rs147410423, rs71680051, rs751044080, rs886063408, rs886063409, rs886063410	RCV000283584 RCV000402364 RCV000305154 RCV000359616 RCV000395703 RCV000335203 RCV000298820 RCV000300139 RCV000264032 RCV000359858
Cervical cancer	Benign; Likely benign	rs149375418, rs143590302	RCV005900484 RCV005906000
Cholangiocarcinoma	Benign	rs2304393	RCV005900493
Colorectal cancer	Uncertain significance; Benign	rs138677601, rs2304393	RCV005923909 RCV005900490
GSN-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	rs199681748, rs752572521, rs200319453, rs758909359, rs375172023, rs374982895, rs754716980, rs139028645, rs143285592, rs147583697, rs151208452, rs115224458, rs2304393, rs774617795, rs116185403 View all (9 more)	RCV003911048 RCV004756342 RCV004756321 RCV003933387 RCV004756349 RCV003958699 RCV003958794 RCV004756359 RCV003418558 RCV004755904 RCV003932513 RCV003912565 RCV003957863 RCV003972537 RCV003932512 RCV003979429 RCV003964005 RCV003924252 RCV003905921 RCV003930787 RCV003968122 RCV003975668 RCV003928765 RCV003963108
Malignant lymphoma, large B-cell, diffuse	Benign	rs2304393	RCV005900489
Malignant tumor of esophagus	Benign; Likely benign	rs149375418	RCV005900483
Ovarian serous cystadenocarcinoma	Benign; Likely benign	rs149375418	RCV005900485
Pancreatic adenocarcinoma	Benign; Likely benign	rs143590302	RCV005906001
Sarcoma	Benign; Likely benign	rs143590302	RCV005906002
Thymoma	Benign	rs2304393	RCV005900492
Uterine carcinosarcoma	Benign	rs2304393	RCV005900491
Uterine corpus endometrial carcinoma	Benign; Likely benign	rs2304393, rs149375418, rs774617795, rs143590302	RCV005900494 RCV005900486 RCV005900482 RCV005906003

Show/Hide Text Mining Associations (136)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	10767822, 16475811, 1652889, 1849145, 19904968, 24747948, 32861330
Acute Coronary Syndrome	Associate	34002800
Adenocarcinoma	Associate	30097534
Adenocarcinoma of Lung	Associate	28404947
Adenoma	Associate	37365287
Alzheimer Disease	Associate	24756957, 36650038
Amyloidosis	Associate	10729296, 10970804, 1652889, 20740538, 24601799, 29069428, 29167514, 29455155, 31243148, 33499149, 33908214, 9109384
Amyloidosis Familial	Associate	10729296, 10767822, 11849445, 1319113, 1652889, 1849145, 2175344, 2176164, 2176481, 22068858, 26915616, 28039894, 29455155, 31243148, 32368002, 36379630, 36650038, 8243656 View all (3 more)
Amyloidosis familial visceral	Associate	20951486, 24601799, 27633054
Amyloidosis Hereditary Transthyretin Related	Associate	20937937
Amyotrophic Lateral Sclerosis	Associate	32792518
Aneurysm	Stimulate	29929532
Arrhythmias Cardiac	Associate	33499149
Arthritis Rheumatoid	Associate	23418544, 27997897, 30662913, 33660820
Blood Platelet Disorders	Associate	28343311
Bone Diseases	Associate	17900349
Bone Diseases Metabolic	Associate	24607942
Brain Concussion	Associate	36834989
Breast Neoplasms	Associate	23324580, 26061043, 26482896
Bulbar Palsy Progressive	Associate	28039894
Carcinoma Hepatocellular	Associate	24614035, 28440466, 36192574
Carcinoma Non Small Cell Lung	Associate	16882345, 22190510, 27121073
Carcinoma Pancreatic Ductal	Inhibit	18584046
Carcinoma Renal Cell	Associate	19752005
Chemical and Drug Induced Liver Injury	Associate	22952982
Cognition Disorders	Associate	36650038
Colonic Neoplasms	Associate	22288069, 35444189
Colonic Neoplasms	Inhibit	27573444
Colonic Polyps	Associate	37365287
Colorectal Neoplasms	Associate	15213223, 22927998, 29476593, 30148861
Colorectal Neoplasms	Stimulate	27391159
Conotruncal cardiac defects	Associate	25393621
Corneal Dystrophies Hereditary	Associate	33499149
Corneal dystrophy epithelial basement membrane	Associate	19710953
COVID 19	Associate	36148234
Cranial Nerve Diseases	Associate	10767822
Cutis Laxa	Associate	24601799
Death	Stimulate	16882345
Death	Associate	22190510
Diabetes Mellitus	Associate	36899335
Down Syndrome	Stimulate	19561443
Drug Hypersensitivity	Inhibit	15300799
Drug Related Side Effects and Adverse Reactions	Inhibit	36650038
Drug Related Side Effects and Adverse Reactions	Associate	36650038
Dystonia	Associate	1985454
Encephalitis Tick Borne	Inhibit	21389683
Esophageal Neoplasms	Associate	25600697
Fatigue Syndrome Chronic	Associate	16049284
Fetal Growth Retardation	Associate	38069155
Fibrosis	Associate	28208683
Frontotemporal Dementia	Associate	32792518
Gamma A Globulin Defect in Assembly of	Associate	28431142
Glioblastoma	Associate	29513714
Glioma	Associate	11916500
Glomerulonephritis IGA	Associate	27997897
Glomerulonephritis IGA	Inhibit	28208683
Heart Diseases	Associate	21389683
Hepatitis B	Associate	20606740
Hepatitis C	Associate	22952982
Hypertension	Associate	40133696
Idiopathic Noncirrhotic Portal Hypertension	Associate	20606740
Infarction	Stimulate	29545349
Infections	Associate	33660820
Inflammation	Associate	21389683, 33660820, 36899335, 37958747
Kidney Diseases	Associate	27633054
Lattice corneal dystrophy type 1	Associate	10767822, 1319113
Lattice Corneal Dystrophy Type II	Associate	10767822, 10995458, 11226240, 19904968, 20937937, 2176481, 24601799, 29599423, 30417985, 32368002, 33499149
Lattice Corneal Dystrophy Type II	Stimulate	9109384
Leukemia	Inhibit	23167427
Leukemia Biphenotypic Acute	Inhibit	32992584
Lipoma	Associate	36881074
Liver Cirrhosis	Associate	20606740
Liver Diseases	Associate	22952982
Liver Failure	Associate	20606740, 28025641
Lupus Erythematosus Systemic	Associate	33660820
Lyme Neuroborreliosis	Inhibit	21389683
Lymphatic Metastasis	Associate	18584046
Mammary Neoplasms Animal	Associate	16217750
Melanoma	Associate	35444189
Meretoja syndrome	Associate	10729296, 32368002
Mesothelioma Malignant	Associate	15920167
Mitochondrial Diseases	Associate	28431142, 34203775
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	34203775
Multiple Myeloma	Associate	27633054
Multiple Sclerosis	Associate	33660820, 37406976
Myasthenia Gravis	Associate	35802752
Myelodysplastic Syndromes	Inhibit	32992584
Nail Patella Syndrome	Associate	7825584
Nasopharyngeal Carcinoma	Associate	28107202
Neonatal Sepsis	Associate	37471663
Neoplasm Invasiveness	Stimulate	16417404
Neoplasm Invasiveness	Associate	30148861
Neoplasm Metastasis	Associate	22190510, 23324580
Neoplasm Metastasis	Inhibit	27573444
Neoplasm Metastasis	Stimulate	36192574
Neoplasms	Associate	11196307, 12216092, 16882345, 17982131, 22190510, 23324580, 25246592, 26823700, 27072581, 27157519, 27391159, 30118659, 31700155, 32992584, 34144901, 34440306, 35444189, 36881074 View all (3 more)
Neoplasms	Inhibit	15300799, 22927998, 23167427, 27573444, 30185973, 37365287
Neoplasms	Stimulate	16417404
Nephrotic Syndrome	Associate	24601799
Nervous System Diseases	Associate	28039894
Neurodegenerative Diseases	Associate	20740538
Oncogene Addiction	Inhibit	15213223
Optic Nerve Diseases	Associate	33499149
Optic Nerve Hypoplasia Bilateral	Associate	33499149
Osteoporosis	Associate	27153759, 37874452
Osteosarcoma	Associate	34440306
Ovalocytosis Hereditary Hemolytic with Defective Erythropoiesis	Associate	32992584
Ovarian Neoplasms	Associate	25246592, 31700155, 38216951
Pain	Stimulate	22998556
Pancreatic Neoplasms	Associate	16847067, 22316387, 27461278
Pancreatic Neoplasms	Inhibit	18584046
Pathological Conditions Anatomical	Associate	22952982
Peritoneal Fibrosis	Stimulate	28673451
Philadelphia Chromosome	Associate	2831714
Plaque Amyloid	Associate	1849145
Pleural Effusion	Associate	29047238
Pre Eclampsia	Stimulate	24296084
Premature Birth	Inhibit	37356366
Proteinuria	Associate	24601799
Pulmonary Disease Chronic Obstructive	Associate	28331304
Pulmonary Embolism	Associate	33825327
Sjogren's Syndrome	Inhibit	33660820
Skin Diseases	Associate	10767822
Squamous Cell Carcinoma of Head and Neck	Associate	30118659, 34144901
Stomach Neoplasms	Associate	26434839, 27058427
Stroke	Associate	29545349
Tarlov Cysts	Associate	30148861
Thymoma	Associate	35802752
Thyroid Cancer Papillary	Associate	37158852
Tuberculosis	Associate	28794177
Tuberculosis Multidrug Resistant	Associate	22190510
Urethral Neoplasms	Associate	12216092
Urinary Bladder Neoplasms	Associate	15300799, 17982131, 37958747
Uterine Cervical Neoplasms	Associate	23925487
Ventricular Fibrillation	Associate	10767822, 2176481
Virus Diseases	Associate	36148234

GSN (gelsolin)