Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2931
Gene name Gene Name - the full gene name approved by the HGNC.	Glycogen synthase kinase 3 alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GSK3A
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, a

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052236	hsa-let-7b-5p	CLASH	23622248
MIRT051796	hsa-let-7c-5p	CLASH	23622248
MIRT045619	hsa-miR-149-5p	CLASH	23622248
MIRT037683	hsa-miR-744-5p	CLASH	23622248
MIRT1035924	hsa-miR-1275	CLIP-seq
MIRT1035925	hsa-miR-184	CLIP-seq
MIRT1035926	hsa-miR-1908	CLIP-seq
MIRT1035927	hsa-miR-3144-5p	CLIP-seq
MIRT1035928	hsa-miR-3180	CLIP-seq
MIRT1035929	hsa-miR-3180-3p	CLIP-seq
MIRT1035930	hsa-miR-3184	CLIP-seq
MIRT1035931	hsa-miR-3191	CLIP-seq
MIRT1035932	hsa-miR-3196	CLIP-seq
MIRT1035933	hsa-miR-3689d	CLIP-seq
MIRT1035934	hsa-miR-423-5p	CLIP-seq
MIRT1035935	hsa-miR-4266	CLIP-seq
MIRT1035936	hsa-miR-4459	CLIP-seq
MIRT1035937	hsa-miR-4525	CLIP-seq
MIRT1035938	hsa-miR-4640-5p	CLIP-seq
MIRT1035939	hsa-miR-4652-5p	CLIP-seq
MIRT1035940	hsa-miR-4653-3p	CLIP-seq
MIRT1035941	hsa-miR-4665-5p	CLIP-seq
MIRT1035942	hsa-miR-4667-5p	CLIP-seq
MIRT1035943	hsa-miR-4695-5p	CLIP-seq
MIRT1035944	hsa-miR-4700-5p	CLIP-seq
MIRT1035945	hsa-miR-4723-5p	CLIP-seq
MIRT1035946	hsa-miR-4726-5p	CLIP-seq
MIRT1035947	hsa-miR-4728-5p	CLIP-seq
MIRT1035948	hsa-miR-4729	CLIP-seq
MIRT1035949	hsa-miR-4779	CLIP-seq
MIRT1035950	hsa-miR-4804-5p	CLIP-seq
MIRT1035951	hsa-miR-491-5p	CLIP-seq
MIRT1035952	hsa-miR-516b	CLIP-seq
MIRT1035953	hsa-miR-625	CLIP-seq
MIRT1035954	hsa-miR-637	CLIP-seq
MIRT1035955	hsa-miR-663	CLIP-seq
MIRT1035956	hsa-miR-744	CLIP-seq
MIRT1035957	hsa-miR-765	CLIP-seq
MIRT1035924	hsa-miR-1275	CLIP-seq
MIRT2007081	hsa-miR-2467-3p	CLIP-seq
MIRT2007082	hsa-miR-28-5p	CLIP-seq
MIRT2007083	hsa-miR-3139	CLIP-seq
MIRT2007084	hsa-miR-3150b-3p	CLIP-seq
MIRT2007085	hsa-miR-3189-3p	CLIP-seq
MIRT2007086	hsa-miR-342-5p	CLIP-seq
MIRT2007087	hsa-miR-3684	CLIP-seq
MIRT2007088	hsa-miR-411	CLIP-seq
MIRT2007089	hsa-miR-4290	CLIP-seq
MIRT2007090	hsa-miR-4419a	CLIP-seq
MIRT2007091	hsa-miR-4436b-3p	CLIP-seq
MIRT1035936	hsa-miR-4459	CLIP-seq
MIRT2007092	hsa-miR-4488	CLIP-seq
MIRT2007093	hsa-miR-4510	CLIP-seq
MIRT2007094	hsa-miR-4651	CLIP-seq
MIRT2007095	hsa-miR-4664-5p	CLIP-seq
MIRT1035941	hsa-miR-4665-5p	CLIP-seq
MIRT2007096	hsa-miR-4685-5p	CLIP-seq
MIRT2007097	hsa-miR-4689	CLIP-seq
MIRT2007098	hsa-miR-4697-5p	CLIP-seq
MIRT2007099	hsa-miR-4710	CLIP-seq
MIRT2007100	hsa-miR-4722-5p	CLIP-seq
MIRT1035949	hsa-miR-4779	CLIP-seq
MIRT2007101	hsa-miR-4784	CLIP-seq
MIRT2007102	hsa-miR-486-3p	CLIP-seq
MIRT2007103	hsa-miR-608	CLIP-seq
MIRT2007104	hsa-miR-708	CLIP-seq
MIRT1035935	hsa-miR-4266	CLIP-seq
MIRT2007089	hsa-miR-4290	CLIP-seq
MIRT2239629	hsa-miR-4470	CLIP-seq
MIRT2239630	hsa-miR-4672	CLIP-seq
MIRT2007096	hsa-miR-4685-5p	CLIP-seq
MIRT1035943	hsa-miR-4695-5p	CLIP-seq
MIRT2007099	hsa-miR-4710	CLIP-seq
MIRT1035947	hsa-miR-4728-5p	CLIP-seq
MIRT2239631	hsa-miR-4742-5p	CLIP-seq
MIRT1035949	hsa-miR-4779	CLIP-seq
MIRT1035957	hsa-miR-765	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
CREB1	Unknown	11579131
NFKB1	Unknown	11579131
RELA	Unknown	11579131

Show/Hide all(108)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003073	Process	Regulation of systemic arterial blood pressure	IEA
GO:0003073	Process	Regulation of systemic arterial blood pressure	ISS
GO:0003214	Process	Cardiac left ventricle morphogenesis	IEA
GO:0003214	Process	Cardiac left ventricle morphogenesis	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	11035810, 25897075
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	8725894, 28386764
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	20371704
GO:0005515	Function	Protein binding	IPI	10481074, 16365045, 17318175, 17510365, 18846110, 19706605, 20368287, 22939624, 23602568, 24705354, 24879152, 25897075, 26496610, 26618561, 28514442, 30824926, 31073040, 32814053, 33961781, 34524948, 35063084, 35271311, 35512704, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS	11035810
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	ISS	18285345
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010508	Process	Positive regulation of autophagy	IBA
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010905	Process	Negative regulation of UDP-glucose catabolic process	IC	11035810
GO:0010975	Process	Regulation of neuron projection development	IBA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019082	Process	Viral protein processing	IEA
GO:0019082	Process	Viral protein processing	TAS
GO:0030154	Process	Cell differentiation	IBA
GO:0030424	Component	Axon	IBA
GO:0030877	Component	Beta-catenin destruction complex	IEA
GO:0030877	Component	Beta-catenin destruction complex	NAS	9601641, 19759537
GO:0030877	Component	Beta-catenin destruction complex	TAS	19366350
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	25897075
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0032007	Process	Negative regulation of TOR signaling	IBA
GO:0032007	Process	Negative regulation of TOR signaling	IEA
GO:0032007	Process	Negative regulation of TOR signaling	ISS
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	25897075
GO:0032869	Process	Cellular response to insulin stimulus	IMP	17569761
GO:0034236	Function	Protein kinase A catalytic subunit binding	IEA
GO:0034236	Function	Protein kinase A catalytic subunit binding	IPI	11035810
GO:0036016	Process	Cellular response to interleukin-3	IEA
GO:0036016	Process	Cellular response to interleukin-3	ISS
GO:0043025	Component	Neuronal cell body	NAS	8725894
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	9601641
GO:0043525	Process	Positive regulation of neuron apoptotic process	IBA
GO:0045719	Process	Negative regulation of glycogen biosynthetic process	IEA
GO:0045719	Process	Negative regulation of glycogen biosynthetic process	TAS	19366350
GO:0045732	Process	Positive regulation of protein catabolic process	NAS	19759537
GO:0045823	Process	Positive regulation of heart contraction	IEA
GO:0045823	Process	Positive regulation of heart contraction	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046325	Process	Negative regulation of D-glucose import	IMP	17569761
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IMP	17569761
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050321	Function	Tau-protein kinase activity	TAS	19366350
GO:0060079	Process	Excitatory postsynaptic potential	NAS	21711983
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	ISS
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IBA
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IEA
GO:0071879	Process	Positive regulation of adenylate cyclase-activating adrenergic receptor signaling pathway	IEA
GO:0071879	Process	Positive regulation of adenylate cyclase-activating adrenergic receptor signaling pathway	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	19366350
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	ISS
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	ISS
GO:0097440	Component	Apical dendrite	NAS	8725894
GO:0098794	Component	Postsynapse	IEA
GO:0106071	Process	Positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0106071	Process	Positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0141068	Process	Autosome genomic imprinting	IEA
GO:0160213	Process	Beta-arrestin-dependent dopamine receptor signaling pathway	NAS	21711983
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IEA
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IEA
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	ISS
GO:1901524	Process	Regulation of mitophagy	IMP	24912190
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902004	Process	Positive regulation of amyloid-beta formation	IGI	12761548
GO:1902004	Process	Positive regulation of amyloid-beta formation	IMP	12761548
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	IMP	24912190
GO:1904951	Process	Positive regulation of establishment of protein localization	IEA
GO:1990635	Component	Proximal dendrite	NAS	8725894
GO:2000077	Process	Negative regulation of type B pancreatic cell development	IEA
GO:2000077	Process	Negative regulation of type B pancreatic cell development	TAS	19366350
GO:2000466	Process	Negative regulation of glycogen (starch) synthase activity	TAS	19366350

MIM	HGNC	e!Ensembl
606784	4616	ENSG00000105723

Protein

UniProt ID

P49840

Protein name

Glycogen synthase kinase-3 alpha (GSK-3 alpha) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3A) (EC 2.7.11.1)

Protein function

Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase

PDB

7SXF , 7SXG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	119 → 403	Protein kinase domain	Domain

Sequence

MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT
DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV
CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS
IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK
AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT
NSS

Sequence length

483

Interactions

View interactions

	KEGG		Reactome
	Chemokine signaling pathway Dopaminergic synapse Non-alcoholic fatty liver disease Shigellosis		XBP1(S) activates chaperone genes Constitutive Signaling by AKT1 E17K in Cancer Suppression of apoptosis

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Cardiomyopathy	Primary dilated cardiomyopathy	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenoma	Inhibit	31506480
Alzheimer Disease	Associate	20080974
Bipolar Disorder	Associate	21040291
Breast Neoplasms	Associate	27150055
Carcinogenesis	Associate	24034838
Carcinogenesis	Stimulate	35292059
Carcinoma Non Small Cell Lung	Associate	25486534
Carcinoma Ovarian Epithelial	Associate	38613588
Carcinoma Renal Cell	Associate	24615012
Cardiomyopathy Dilated	Associate	28701297
Colorectal Neoplasms	Associate	16984735, 37031867
Diabetes Mellitus	Associate	20080974
Drug Related Side Effects and Adverse Reactions	Associate	20920357
Esophageal Squamous Cell Carcinoma	Associate	18084253
Fibrosis	Associate	37656238
Heart Diseases	Stimulate	37656238
Hypertrophy	Associate	37656238
Inflammation	Associate	29434052, 37656238
Leiomyoma	Associate	19464003
Leukemia Myeloid Acute	Associate	22326953, 29515000, 30679640
Leukemia Myeloid Acute	Inhibit	28625976
Melanoma	Associate	24034838
Mouth Neoplasms	Associate	25645517
Multiple Myeloma	Associate	20920357
Neoplasms	Associate	20080974, 20920357, 24034838, 35292059, 37686063
Neuroblastoma	Associate	24521712
Neuroendocrine Tumors	Associate	24521712
Ovarian Neoplasms	Associate	35840928
Pancreatic Neoplasms	Associate	18829575, 26147011
Polycythemia Vera	Associate	15676208
Squamous Cell Carcinoma of Head and Neck	Associate	25645517
Stomach Neoplasms	Associate	34607506
Tongue Diseases	Stimulate	25645517
Tongue Neoplasms	Associate	25645517
Ventricular Remodeling	Associate	37656238

GSK3A (glycogen synthase kinase 3 alpha)