Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2920
Gene name Gene Name - the full gene name approved by the HGNC.
C-X-C motif chemokine ligand 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CXCL2
Synonyms (NCBI Gene) Gene synonyms aliases
CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residue
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018317 hsa-miR-335-5p Microarray 18185580
MIRT023893 hsa-miR-1-3p Microarray 18668037
MIRT027726 hsa-miR-98-5p Microarray 19088304
MIRT438285 hsa-miR-223-3p Luciferase reporter assay 24084739
MIRT438285 hsa-miR-223-3p Luciferase reporter assay 24084739
Transcription factors
Transcription factor Regulation Reference
NFKB1 Unknown 17363596
RELA Unknown 17363596
SMAD1 Unknown 17363596
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002237 Process Response to molecule of bacterial origin IDA 19912257
GO:0005515 Function Protein binding IPI 18275857, 21314817, 28381538
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0006935 Process Chemotaxis TAS 2643119
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
139110 4603 ENSG00000081041
Protein
UniProt ID P19875
Protein name C-X-C motif chemokine 2 (Growth-regulated protein beta) (Gro-beta) (Macrophage inflammatory protein 2-alpha) (MIP2-alpha) [Cleaved into: GRO-beta(5-73) (GRO-beta-T) (Hematopoietic synergistic factor) (HSF) (SB-251353)]
Protein function Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic act
PDB 1QNK , 5OB5 , 8XVU , 8XXH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 41 100 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM
LKNGKSN
Sequence length 107
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NF-kappa B signaling pathway
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Alcoholic liver disease
Epithelial cell signaling in Helicobacter pylori infection
Legionellosis
Amoebiasis
Kaposi sarcoma-associated herpesvirus infection
Rheumatoid arthritis
Lipid and atherosclerosis
  Chemokine receptors bind chemokines
G alpha (i) signalling events
Interleukin-10 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Degenerative polyarthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 15292528
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
16298037
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
16298037
Cholestasis Cholestasis rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039 21224055
Unknown
Disease term Disease name Evidence References Source
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease 23099361 ClinVar
Congestive heart failure Congestive heart failure 22352330 ClinVar
Heart failure Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided 22352330 ClinVar
Myocardial infarction Myocardial Failure 22352330 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Acute Lung Injury Associate 37603512
Adenocarcinoma Associate 34269159
Adenocarcinoma of Lung Associate 40682067
Adenoma Associate 21249124
Adrenocortical Carcinoma Associate 35500219
Alopecia Areata Associate 26345899
Amyotrophic Lateral Sclerosis Associate 28437540
Arthritis Experimental Stimulate 15146413
Arthritis Juvenile Associate 39699225
Arthritis Rheumatoid Associate 18205922, 28767591