Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2919
Gene name Gene Name - the full gene name approved by the HGNC.	C-X-C motif chemokine ligand 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CXCL1
Synonyms (NCBI Gene) Gene synonyms aliases	FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattra

Show/Hide all(246)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023084	hsa-miR-124-3p	Microarray	18668037
MIRT023999	hsa-miR-1-3p	Microarray	18668037
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT734007	hsa-miR-302e	Luciferase reporter assay, qRT-PCR, Western blotting	34079750
MIRT613684	hsa-miR-27b-5p	Luciferase reporter assay, qRT-PCR	32782028
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT756129	hsa-miR-34c-5p	Luciferase reporter assay, Microarray, qRT-PCR, Immunofluorescence, ELISA	36829591
MIRT756130	hsa-miR-34b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Immunofluorescence, ELISA	36829591
MIRT917939	hsa-miR-371-5p	CLIP-seq
MIRT1972088	hsa-miR-1184	CLIP-seq
MIRT1972089	hsa-miR-1205	CLIP-seq
MIRT1972090	hsa-miR-1301	CLIP-seq
MIRT1972091	hsa-miR-3158-5p	CLIP-seq
MIRT1972092	hsa-miR-3545-3p	CLIP-seq
MIRT1972093	hsa-miR-4517	CLIP-seq
MIRT1972094	hsa-miR-4660	CLIP-seq
MIRT1972095	hsa-miR-4757-5p	CLIP-seq
MIRT1972096	hsa-miR-5047	CLIP-seq
MIRT2207914	hsa-miR-181a	CLIP-seq
MIRT2207915	hsa-miR-181b	CLIP-seq
MIRT2207916	hsa-miR-181c	CLIP-seq
MIRT2207917	hsa-miR-181d	CLIP-seq
MIRT2207918	hsa-miR-4262	CLIP-seq
MIRT2436544	hsa-miR-1237	CLIP-seq
MIRT2436545	hsa-miR-3155	CLIP-seq
MIRT2436546	hsa-miR-3155b	CLIP-seq
MIRT2436547	hsa-miR-3622b-5p	CLIP-seq
MIRT2436548	hsa-miR-4268	CLIP-seq
MIRT2436549	hsa-miR-4287	CLIP-seq
MIRT2436550	hsa-miR-4684-3p	CLIP-seq
MIRT2436551	hsa-miR-4685-3p	CLIP-seq
MIRT2436552	hsa-miR-4691-5p	CLIP-seq
MIRT2436553	hsa-miR-484	CLIP-seq
MIRT2436554	hsa-miR-516a-3p	CLIP-seq
MIRT1972088	hsa-miR-1184	CLIP-seq
MIRT2511174	hsa-miR-1197	CLIP-seq
MIRT1972089	hsa-miR-1205	CLIP-seq
MIRT2511175	hsa-miR-1273e	CLIP-seq
MIRT2511176	hsa-miR-128	CLIP-seq
MIRT1972090	hsa-miR-1301	CLIP-seq
MIRT2511177	hsa-miR-1305	CLIP-seq
MIRT2511178	hsa-miR-141	CLIP-seq
MIRT2207914	hsa-miR-181a	CLIP-seq
MIRT2207915	hsa-miR-181b	CLIP-seq
MIRT2207916	hsa-miR-181c	CLIP-seq
MIRT2207917	hsa-miR-181d	CLIP-seq
MIRT2511179	hsa-miR-186	CLIP-seq
MIRT2511180	hsa-miR-200a	CLIP-seq
MIRT2511181	hsa-miR-2116	CLIP-seq
MIRT2511182	hsa-miR-2682	CLIP-seq
MIRT2511183	hsa-miR-27a	CLIP-seq
MIRT2511184	hsa-miR-27b	CLIP-seq
MIRT2511185	hsa-miR-3143	CLIP-seq
MIRT2511186	hsa-miR-3145-3p	CLIP-seq
MIRT2436545	hsa-miR-3155	CLIP-seq
MIRT2436546	hsa-miR-3155b	CLIP-seq
MIRT1972091	hsa-miR-3158-5p	CLIP-seq
MIRT2511187	hsa-miR-3163	CLIP-seq
MIRT2511188	hsa-miR-3168	CLIP-seq
MIRT2511189	hsa-miR-3170	CLIP-seq
MIRT2511190	hsa-miR-3187-3p	CLIP-seq
MIRT2511191	hsa-miR-3194-5p	CLIP-seq
MIRT2511192	hsa-miR-331-3p	CLIP-seq
MIRT1972092	hsa-miR-3545-3p	CLIP-seq
MIRT2511193	hsa-miR-3607-3p	CLIP-seq
MIRT2511194	hsa-miR-3613-3p	CLIP-seq
MIRT2511195	hsa-miR-3617	CLIP-seq
MIRT2511196	hsa-miR-3622a-5p	CLIP-seq
MIRT2436547	hsa-miR-3622b-5p	CLIP-seq
MIRT2511197	hsa-miR-3652	CLIP-seq
MIRT2511198	hsa-miR-3662	CLIP-seq
MIRT2511199	hsa-miR-3665	CLIP-seq
MIRT2511200	hsa-miR-3671	CLIP-seq
MIRT2511201	hsa-miR-369-3p	CLIP-seq
MIRT2511202	hsa-miR-3714	CLIP-seq
MIRT2511203	hsa-miR-374a	CLIP-seq
MIRT2511204	hsa-miR-374b	CLIP-seq
MIRT2511205	hsa-miR-3927	CLIP-seq
MIRT2511206	hsa-miR-3944-5p	CLIP-seq
MIRT2511207	hsa-miR-409-3p	CLIP-seq
MIRT2511208	hsa-miR-421	CLIP-seq
MIRT2207918	hsa-miR-4262	CLIP-seq
MIRT2436548	hsa-miR-4268	CLIP-seq
MIRT2436549	hsa-miR-4287	CLIP-seq
MIRT2511209	hsa-miR-4297	CLIP-seq
MIRT2511210	hsa-miR-4302	CLIP-seq
MIRT2511211	hsa-miR-4423-3p	CLIP-seq
MIRT2511212	hsa-miR-4424	CLIP-seq
MIRT2511213	hsa-miR-4430	CLIP-seq
MIRT2511214	hsa-miR-4434	CLIP-seq
MIRT2511215	hsa-miR-4435	CLIP-seq
MIRT2511216	hsa-miR-4451	CLIP-seq
MIRT2511217	hsa-miR-449c	CLIP-seq
MIRT2511218	hsa-miR-4505	CLIP-seq
MIRT2511219	hsa-miR-4516	CLIP-seq
MIRT1972093	hsa-miR-4517	CLIP-seq
MIRT2511220	hsa-miR-4529-5p	CLIP-seq
MIRT2511221	hsa-miR-4531	CLIP-seq
MIRT2511222	hsa-miR-4633-5p	CLIP-seq
MIRT2511223	hsa-miR-4637	CLIP-seq
MIRT1972094	hsa-miR-4660	CLIP-seq
MIRT2436550	hsa-miR-4684-3p	CLIP-seq
MIRT2436551	hsa-miR-4685-3p	CLIP-seq
MIRT2436552	hsa-miR-4691-5p	CLIP-seq
MIRT2511224	hsa-miR-4695-3p	CLIP-seq
MIRT2511225	hsa-miR-4701-5p	CLIP-seq
MIRT2511226	hsa-miR-4720-5p	CLIP-seq
MIRT2511227	hsa-miR-4724-3p	CLIP-seq
MIRT1972095	hsa-miR-4757-5p	CLIP-seq
MIRT2511228	hsa-miR-4773	CLIP-seq
MIRT2511229	hsa-miR-4799-3p	CLIP-seq
MIRT2511230	hsa-miR-4803	CLIP-seq
MIRT2436553	hsa-miR-484	CLIP-seq
MIRT2511231	hsa-miR-487a	CLIP-seq
MIRT2511232	hsa-miR-489	CLIP-seq
MIRT1972096	hsa-miR-5047	CLIP-seq
MIRT2511233	hsa-miR-513b	CLIP-seq
MIRT2436554	hsa-miR-516a-3p	CLIP-seq
MIRT2511234	hsa-miR-520d-5p	CLIP-seq
MIRT2511235	hsa-miR-524-5p	CLIP-seq
MIRT2511236	hsa-miR-532-5p	CLIP-seq
MIRT2511237	hsa-miR-539	CLIP-seq
MIRT2511238	hsa-miR-543	CLIP-seq
MIRT2511239	hsa-miR-548a-3p	CLIP-seq
MIRT2511240	hsa-miR-548e	CLIP-seq
MIRT2511241	hsa-miR-548f	CLIP-seq
MIRT2511242	hsa-miR-548s	CLIP-seq
MIRT2511243	hsa-miR-561	CLIP-seq
MIRT2511244	hsa-miR-563	CLIP-seq
MIRT2511245	hsa-miR-570	CLIP-seq
MIRT2511246	hsa-miR-576-3p	CLIP-seq
MIRT2511247	hsa-miR-588	CLIP-seq
MIRT2511248	hsa-miR-607	CLIP-seq
MIRT2511249	hsa-miR-641	CLIP-seq
MIRT2511250	hsa-miR-648	CLIP-seq
MIRT2511251	hsa-miR-657	CLIP-seq
MIRT2511252	hsa-miR-935	CLIP-seq
MIRT2511253	hsa-miR-944	CLIP-seq
MIRT1972088	hsa-miR-1184	CLIP-seq
MIRT2511174	hsa-miR-1197	CLIP-seq
MIRT1972089	hsa-miR-1205	CLIP-seq
MIRT2436544	hsa-miR-1237	CLIP-seq
MIRT2678849	hsa-miR-1238	CLIP-seq
MIRT2511175	hsa-miR-1273e	CLIP-seq
MIRT2511176	hsa-miR-128	CLIP-seq
MIRT1972090	hsa-miR-1301	CLIP-seq
MIRT2511177	hsa-miR-1305	CLIP-seq
MIRT2207914	hsa-miR-181a	CLIP-seq
MIRT2207915	hsa-miR-181b	CLIP-seq
MIRT2207916	hsa-miR-181c	CLIP-seq
MIRT2207917	hsa-miR-181d	CLIP-seq
MIRT2511179	hsa-miR-186	CLIP-seq
MIRT2678850	hsa-miR-205	CLIP-seq
MIRT2511181	hsa-miR-2116	CLIP-seq
MIRT2511183	hsa-miR-27a	CLIP-seq
MIRT2511184	hsa-miR-27b	CLIP-seq
MIRT2678851	hsa-miR-3124-3p	CLIP-seq
MIRT2511185	hsa-miR-3143	CLIP-seq
MIRT2511186	hsa-miR-3145-3p	CLIP-seq
MIRT2436545	hsa-miR-3155	CLIP-seq
MIRT2436546	hsa-miR-3155b	CLIP-seq
MIRT1972091	hsa-miR-3158-5p	CLIP-seq
MIRT2511187	hsa-miR-3163	CLIP-seq
MIRT2511188	hsa-miR-3168	CLIP-seq
MIRT2511189	hsa-miR-3170	CLIP-seq
MIRT2511190	hsa-miR-3187-3p	CLIP-seq
MIRT2511191	hsa-miR-3194-5p	CLIP-seq
MIRT2511192	hsa-miR-331-3p	CLIP-seq
MIRT1972092	hsa-miR-3545-3p	CLIP-seq
MIRT2511194	hsa-miR-3613-3p	CLIP-seq
MIRT2436547	hsa-miR-3622b-5p	CLIP-seq
MIRT2511197	hsa-miR-3652	CLIP-seq
MIRT2511198	hsa-miR-3662	CLIP-seq
MIRT2511199	hsa-miR-3665	CLIP-seq
MIRT2511200	hsa-miR-3671	CLIP-seq
MIRT2511201	hsa-miR-369-3p	CLIP-seq
MIRT2511203	hsa-miR-374a	CLIP-seq
MIRT2511204	hsa-miR-374b	CLIP-seq
MIRT2678852	hsa-miR-3918	CLIP-seq
MIRT2511205	hsa-miR-3927	CLIP-seq
MIRT2511206	hsa-miR-3944-5p	CLIP-seq
MIRT2511207	hsa-miR-409-3p	CLIP-seq
MIRT2511208	hsa-miR-421	CLIP-seq
MIRT2207918	hsa-miR-4262	CLIP-seq
MIRT2436548	hsa-miR-4268	CLIP-seq
MIRT2436549	hsa-miR-4287	CLIP-seq
MIRT2511209	hsa-miR-4297	CLIP-seq
MIRT2511210	hsa-miR-4302	CLIP-seq
MIRT2511212	hsa-miR-4424	CLIP-seq
MIRT2511213	hsa-miR-4430	CLIP-seq
MIRT2511214	hsa-miR-4434	CLIP-seq
MIRT2511215	hsa-miR-4435	CLIP-seq
MIRT2511216	hsa-miR-4451	CLIP-seq
MIRT2511218	hsa-miR-4505	CLIP-seq
MIRT2678853	hsa-miR-4512	CLIP-seq
MIRT2511219	hsa-miR-4516	CLIP-seq
MIRT1972093	hsa-miR-4517	CLIP-seq
MIRT2511220	hsa-miR-4529-5p	CLIP-seq
MIRT2511221	hsa-miR-4531	CLIP-seq
MIRT2511223	hsa-miR-4637	CLIP-seq
MIRT1972094	hsa-miR-4660	CLIP-seq
MIRT2436550	hsa-miR-4684-3p	CLIP-seq
MIRT2436551	hsa-miR-4685-3p	CLIP-seq
MIRT2678854	hsa-miR-4691-3p	CLIP-seq
MIRT2436552	hsa-miR-4691-5p	CLIP-seq
MIRT2511224	hsa-miR-4695-3p	CLIP-seq
MIRT2511225	hsa-miR-4701-5p	CLIP-seq
MIRT2678855	hsa-miR-4711-3p	CLIP-seq
MIRT2511226	hsa-miR-4720-5p	CLIP-seq
MIRT2511227	hsa-miR-4724-3p	CLIP-seq
MIRT2678856	hsa-miR-4753-3p	CLIP-seq
MIRT1972095	hsa-miR-4757-5p	CLIP-seq
MIRT2511228	hsa-miR-4773	CLIP-seq
MIRT2511229	hsa-miR-4799-3p	CLIP-seq
MIRT2511230	hsa-miR-4803	CLIP-seq
MIRT2436553	hsa-miR-484	CLIP-seq
MIRT2511231	hsa-miR-487a	CLIP-seq
MIRT2511232	hsa-miR-489	CLIP-seq
MIRT1972096	hsa-miR-5047	CLIP-seq
MIRT2511233	hsa-miR-513b	CLIP-seq
MIRT2436554	hsa-miR-516a-3p	CLIP-seq
MIRT2511234	hsa-miR-520d-5p	CLIP-seq
MIRT2511235	hsa-miR-524-5p	CLIP-seq
MIRT2511237	hsa-miR-539	CLIP-seq
MIRT2511238	hsa-miR-543	CLIP-seq
MIRT2511242	hsa-miR-548s	CLIP-seq
MIRT2511243	hsa-miR-561	CLIP-seq
MIRT2511244	hsa-miR-563	CLIP-seq
MIRT2511245	hsa-miR-570	CLIP-seq
MIRT2511246	hsa-miR-576-3p	CLIP-seq
MIRT2511247	hsa-miR-588	CLIP-seq
MIRT2678857	hsa-miR-593	CLIP-seq
MIRT2678858	hsa-miR-603	CLIP-seq
MIRT2511248	hsa-miR-607	CLIP-seq
MIRT2511250	hsa-miR-648	CLIP-seq
MIRT2511251	hsa-miR-657	CLIP-seq
MIRT2678859	hsa-miR-873	CLIP-seq
MIRT2511252	hsa-miR-935	CLIP-seq

Transcription factors

Show/Hide all(10)

Transcription factor	Regulation	Reference
BRCA1	Repression	22120723
CEBPD	Activation	23028973
GATA3	Repression	22120723
HMGA1	Unknown	11112786;7479086
NFKB1	Activation	10530453;15958549
NFKB1	Unknown	11112786;16040075;7479086
PARP1	Unknown	11112786
RELA	Activation	10530453;15958549
RELA	Unknown	11112786;16040075
SP1	Unknown	11112786;7479086

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	9079638, 10820279
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006935	Process	Chemotaxis	TAS	10820279
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9725262, 10820279
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007399	Process	Nervous system development	TAS	9058825
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008047	Function	Enzyme activator activity	TAS	9079638
GO:0008083	Function	Growth factor activity	TAS	8380167
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9551928
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030036	Process	Actin cytoskeleton organization	TAS	9725262
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0035556	Process	Intracellular signal transduction	TAS	9551928
GO:0035580	Component	Specific granule lumen	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045236	Function	CXCR chemokine receptor binding	IBA	21873635
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA	21873635
GO:1904724	Component	Tertiary granule lumen	TAS

MIM	HGNC	e!Ensembl
155730	4602	ENSG00000163739

Protein

UniProt ID

P09341

Protein name

Growth-regulated alpha protein (C-X-C motif chemokine 1) (GRO-alpha(1-73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil-activating protein 3) (NAP-3) [Cleaved into: GRO-alpha(4-73); GRO-alpha(5-73); GRO-alpha(6-73)]

Protein function

Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold high

PDB

1MGS , 1MSG , 1MSH , 1ROD , 8K4O , 8XWA , 8XWV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	41 → 100	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Sequence

MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Sequence length

107

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway NF-kappa B signaling pathway NOD-like receptor signaling pathway IL-17 signaling pathway TNF signaling pathway Alcoholic liver disease Epithelial cell signaling in Helicobacter pylori infection Legionellosis Amoebiasis Kaposi sarcoma-associated herpesvirus infection Rheumatoid arthritis Lipid and atherosclerosis		Chemokine receptors bind chemokines G alpha (i) signalling events Interleukin-10 signaling Neutrophil degranulation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease		23099361	ClinVar

Show/Hide Text Mining Associations (227)

Disease Name	Relationship Type	References
Associations from Text Mining
Acne Vulgaris	Associate	31281837
Acute Coronary Syndrome	Associate	30514120
Acute Febrile Encephalopathy	Stimulate	15608388
Acute Kidney Injury	Associate	23511138
Adenocarcinoma	Associate	34269159, 34724890
Adenoma	Associate	21249124, 23155391
Alcoholic Neuropathy	Stimulate	17594598
Alopecia Areata	Inhibit	23502337
Alopecia Areata	Associate	26345899
Alzheimer Disease	Associate	38178159, 40613333
Amyotrophic Lateral Sclerosis	Associate	28437540
Aortic Dissection	Associate	39991758
Arthritis Juvenile	Associate	28012239, 34963488
Arthritis Psoriatic	Associate	10086850, 1732389, 35055107, 9424095
Arthritis Psoriatic	Stimulate	8245503
Arthritis Rheumatoid	Stimulate	10337033, 10437780, 28850672
Arthritis Rheumatoid	Associate	18205922, 28708839, 33066816, 33087182
Ascites	Associate	31039761
Asthma	Associate	18774390, 20371397, 34727921, 36197221
Asthma	Stimulate	19017877
Asthma	Inhibit	40696647
Atrial Fibrillation	Associate	32383373
Atypical Squamous Cells of the Cervix	Associate	29887999
Bacteremia	Associate	39966757
beta Thalassemia	Associate	24894780
Breast Neoplasms	Associate	18045955, 18248671, 19451693, 25344051, 29495008, 36581948, 39287311
Breast Neoplasms	Inhibit	20030852, 39518934
Breast Neoplasms	Stimulate	28560447, 31322183
Bronchiolitis Obliterans Syndrome	Associate	25828101
Calcinosis Cutis	Associate	35940046
Carcinogenesis	Associate	11371564, 17060621, 23815949, 29784873, 34218518
Carcinogenesis	Stimulate	25485576
Carcinoma Hepatocellular	Associate	24260493, 26503598, 29962817, 36411463, 36975480
Carcinoma Hepatocellular	Inhibit	36938723
Carcinoma Non Small Cell Lung	Associate	21298036
Carcinoma Renal Cell	Associate	32481352, 37540227, 37622107
Carcinoma Squamous Cell	Associate	23890481
Cardiovascular Diseases	Associate	36035865
Carotid Stenosis	Associate	28637660
Cartilage Diseases	Associate	18205922, 31981738
Cell Transformation Neoplastic	Associate	31637480
Cerebral Infarction	Associate	31183363
Cerebrovascular Disorders	Associate	24619879
Cheilitis glandularis	Stimulate	28285559
Cholangiocarcinoma	Associate	35377900
Chronic Disease	Inhibit	35218958
Chronic Periodontitis	Associate	30760334
Colitis	Associate	30227886
Colitis Ulcerative	Associate	32190668, 33462173, 34717557, 36854781, 38070204
Colonic Neoplasms	Associate	32788867, 34473751, 35958781, 36246978, 38031087
Colonic Polyps	Associate	38297356
Colorectal Neoplasms	Associate	16101183, 18578857, 19957108, 21285972, 23155391, 26208990, 27091625, 27472713, 29784873, 30973890, 31137244, 31893510, 32058945, 32351322, 32462020 View all (8 more)
Colorectal Neoplasms	Stimulate	32337262, 34233297, 36434686
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	19957108
Coronary Artery Disease	Associate	12871498
Cough	Associate	28842514
COVID 19	Associate	33726831, 34020127, 34582497
COVID 19	Stimulate	34262555, 34413339
Craniopharyngioma	Associate	28859336
Crohn Disease	Associate	27267052, 34106269, 37496049, 39475676
Cystic Fibrosis	Associate	19399182
Cystitis	Associate	30905425
Cystitis Interstitial	Associate	33848079
Cystitis Interstitial	Stimulate	36045687
Demyelinating Diseases	Stimulate	17594598
Depressive Disorder Major	Associate	26171980
Dermatitis Allergic Contact	Stimulate	39408763
Dermatitis Atopic	Associate	22272250, 25315214, 27304428
Dermatitis Atopic	Stimulate	31892708
Diabetes Mellitus	Associate	39966757
Diabetes Mellitus Type 1	Associate	35381625
Diabetes Mellitus Type 2	Associate	40127075
Diabetic Ketoacidosis	Associate	24619879
Diabetic Nephropathies	Associate	32778679, 37986381, 38206700
Diabetic Neuropathies	Associate	17594598
Diarrhea	Associate	30227886
Dyskeratosis Congenita	Associate	37717172
Endocarditis	Associate	25776751
Endometriosis	Associate	30475413
Endometritis	Associate	20495539
Enterocolitis Necrotizing	Associate	34269788
Eosinophilic Esophagitis	Associate	39343172
Epilepsy	Associate	34555062
Esophageal Squamous Cell Carcinoma	Associate	28518141, 34218518, 34404882
Familial Mediterranean Fever	Associate	39440870
Femoracetabular Impingement	Associate	23965695
Fibrosis	Associate	24260493, 37266443
Fibrosis	Inhibit	26314558
Frontotemporal Dementia	Stimulate	37268663
Frontotemporal Dementia	Associate	40613333
Gastritis	Associate	11091274
Gastrointestinal Stromal Tumors	Associate	25120735
Glioblastoma	Associate	32534425, 33571109
Glioma	Associate	30379898
Glomerulonephritis IGA	Associate	24023680
Granulomatous Disease Chronic	Associate	14688376
Growth Disorders	Associate	11112786
Growth Disorders	Stimulate	9424095
Hand Foot and Mouth Disease	Associate	24367714
Heart Diseases	Associate	39966757
Heart Failure	Associate	29784904
Helicobacter Infections	Stimulate	9659152
Hemolytic Uremic Syndrome	Associate	35185912
Hepatitis C	Associate	26314558
Hidradenitis Suppurativa	Stimulate	33766512
Hip Injuries	Associate	23965695
Hodgkin Disease	Associate	12734381
Hypertension	Stimulate	39595551
Hypertension Pregnancy Induced	Inhibit	39503530
Hypertrophy	Stimulate	25279550
Hypoxia	Stimulate	20729179
Hypoxia Brain	Stimulate	35043517
Ichthyosis	Associate	27554821
Idiopathic Noncirrhotic Portal Hypertension	Associate	24260493
Idiopathic Pulmonary Fibrosis	Associate	32899090
IgA Vasculitis	Associate	15608388
Immunoglobulin Light chain Amyloidosis	Associate	32922167
Infections	Stimulate	10023340, 34256007, 36131109
Infections	Associate	25404022
Inflammation	Associate	11115149, 11371564, 15008987, 17594598, 19376732, 19399182, 20962773, 21249124, 22503040, 23613363, 24778119, 24825356, 25766782, 2670560, 27163710 View all (30 more)
Inflammation	Stimulate	31991796, 36131109
Inflammatory Bowel Diseases	Associate	32020185, 38199515
Inflammatory Breast Neoplasms	Associate	18248671
Influenza Human	Inhibit	9064338
Intervertebral Disc Degeneration	Associate	35042389
Intestinal Polyposis	Stimulate	38297356
Kidney Neoplasms	Associate	37540227
Leukemia	Associate	37554265
Leukemia Lymphocytic Chronic B Cell	Associate	31409670
Leukemia Monocytic Acute	Associate	10765922
Lewy Body Disease	Associate	40613333
Lichen Planus Oral	Associate	24581860
Liver Cirrhosis Alcoholic	Associate	24260493, 31637480
Liver Cirrhosis Biliary	Associate	34367180
Liver Diseases	Associate	39619227
Liver Diseases Alcoholic	Associate	31637480
Lung Diseases	Associate	38158808
Lung Diseases Interstitial	Associate	37266432
Lung Neoplasms	Associate	23665907, 38158808
Lupus Erythematosus Systemic	Associate	33685997
Lymphangioleiomyomatosis	Stimulate	19155472
Lymphatic Metastasis	Associate	20731665, 27472713, 27748927, 28575019, 35377900, 38158808
Lymphoma	Associate	30379898
Lymphoma Large B Cell Diffuse	Associate	22980495
Majeed syndrome	Associate	33314777
MASS syndrome	Associate	21928244
Measles	Stimulate	12808325
Medulloblastoma	Associate	32539808
Melanoma	Associate	11112213, 11773061, 1372901, 15899804, 16098041, 16799643, 20030852, 2217207, 22225770, 22441657, 25560632, 25944800, 2670560, 34799355, 35043517 View all (5 more)
Melanoma	Stimulate	11112786, 1732389, 30870978, 35538545, 7479086
Melanoma	Inhibit	37481560
Mental Disorders	Associate	39566744
Migraine Disorders	Associate	31214186
Mouth Neoplasms	Associate	26462152, 34384424
Mucocutaneous Lymph Node Syndrome	Associate	12808325, 15608388
Multiple Myeloma	Associate	25268740, 32922167
Myasthenia Gravis	Associate	28045063
Myocardial Infarction	Associate	31772617, 32594092, 33847684, 39809140
Myositis	Associate	40114239
Nasal Polyps	Stimulate	19178793
Neoplasm Metastasis	Associate	18045955, 18578857, 21343381, 22753015, 27091625, 27472713, 29784873, 35764974, 36810912
Neoplasm Metastasis	Stimulate	31500632, 32539808, 35940046, 40235059
Neoplasms	Associate	12734381, 16799643, 18045955, 18578857, 19258312, 19957108, 20169105, 20731665, 21343381, 21483804, 21928244, 22893706, 23155391, 23665907, 23815949 View all (32 more)
Neoplasms	Stimulate	21131600, 21285972, 23890481
Neoplasms	Inhibit	21298036, 29495008, 34020271, 34517533
Neoplasms Adipose Tissue	Associate	35894174
Neoplasms Cystic Mucinous and Serous	Associate	33579221
Neurofibrosarcoma	Associate	34079083
Neuroinflammatory Diseases	Associate	37548929
Non alcoholic Fatty Liver Disease	Associate	32594092
Obesity	Inhibit	29784904
Obesity	Associate	29887999, 33487124, 35894174
Osteoarthritis	Stimulate	10437780
Osteoarthritis	Associate	12483724, 21134476, 25279550, 33087182
Ovarian Diseases	Associate	17060621
Ovarian Neoplasms	Associate	17060621, 18719363, 21928244, 23300534, 24376747, 26462152, 27472713, 32326946, 32851734, 34995016, 35618786, 37787042
Ovarian Neoplasms	Stimulate	34794429
Pancreatic Neoplasms	Associate	27472713, 29157747
Peri Implantitis	Associate	36013591
Periodontitis	Associate	34859622, 38206700
Periodontitis	Stimulate	35154475
Peritonitis	Associate	28575019
Peritonsillar Abscess	Associate	15008987
Placenta Diseases	Associate	30402038
Plaque Atherosclerotic	Stimulate	28637660
Pneumococcal Infections	Stimulate	12952922, 37358300
Pneumonia	Associate	28381820
Polycystic Ovary Syndrome	Associate	24279306
Polyendocrinopathies Autoimmune	Associate	17223652
Post Acute COVID 19 Syndrome	Stimulate	38326527
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19388934, 20729179
Prostatic Neoplasms	Associate	31500632, 32339056, 39518934
Psoriasis	Associate	1732389, 33416099, 36765431, 38003437, 38115636
Psychotic Disorders	Associate	25970596
Pulmonary Disease Chronic Obstructive	Associate	20395558, 30395484, 30676127, 34145303, 34335580, 36017119
Pyelonephritis	Associate	27352120, 30905425
Pyoderma Gangrenosum	Stimulate	24903614
Pyoderma Gangrenosum	Associate	25501066
Pyruvate Carboxylase Deficiency Disease	Associate	36224527
Radiation Pneumonitis	Associate	33109238
Recombinant chromosome 8 syndrome	Stimulate	35618786
Recurrent respiratory papillomatosis	Associate	34669519
Renal Insufficiency Chronic	Stimulate	37711613
Reperfusion Injury	Stimulate	33670793
Retinal Perforations	Associate	33430811
Rhegmatogenous Retinal Detachment Autosomal Dominant	Associate	25766782
Rheumatic Diseases	Associate	12483724
Small Cell Lung Carcinoma	Associate	25301363
Spastic paraplegia 4 autosomal dominant	Associate	9507385
Squamous Cell Carcinoma of Head and Neck	Associate	18254958, 21085979, 26462152, 36328378
Stomach Neoplasms	Associate	14632759, 21343381, 23815949, 27748927, 28575019, 29283424, 36614235
Stomach Neoplasms	Stimulate	20731665
Subarachnoid Hemorrhage	Associate	38173028
Sweet Syndrome	Associate	24903614
Tarlov Cysts	Associate	27472713
Thalassemia	Stimulate	24894780
Thrombocythemia Essential	Associate	31801935
Thrombocytopenia Neonatal Alloimmune	Associate	9163597
Thyroid Cancer Papillary	Associate	35515000
Tibial Meniscus Injuries	Inhibit	24315792
Tonsillitis	Associate	15008987, 15807854
Triple Negative Breast Neoplasms	Stimulate	28560447
Triple Negative Breast Neoplasms	Associate	28750689, 33959656, 35377948
Urinary Bladder Neoplasms	Associate	23815949, 29854840, 30816487, 34517533
Urinary Bladder Neoplasms	Stimulate	28285559
Uterine Cervical Neoplasms	Associate	35264061, 35764974
Vitreoretinopathy Proliferative	Associate	25766782

CXCL1 (C-X-C motif chemokine ligand 1)