Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2919
Gene name	C-X-C motif chemokine ligand 1
Gene symbol	CXCL1
Synonyms (NCBI Gene)	FSPGRO1GROaMGSAMGSA-aNAP-3SCYB1
Chromosome	4
Chromosome location	4q13.3
Summary	This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattra

246

Show/Hide all (246)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023084	hsa-miR-124-3p	Microarray	18668037
MIRT023999	hsa-miR-1-3p	Microarray	18668037
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT734007	hsa-miR-302e	Luciferase reporter assayqRT-PCRWestern blotting	34079750
MIRT613684	hsa-miR-27b-5p	Luciferase reporter assayqRT-PCR	32782028
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT756129	hsa-miR-34c-5p	Luciferase reporter assayMicroarrayqRT-PCRImmunofluorescenceELISA	36829591
MIRT756130	hsa-miR-34b-5p	Luciferase reporter assayMicroarrayqRT-PCRImmunofluorescenceELISA	36829591
MIRT917939	hsa-miR-371-5p	CLIP-seq
MIRT1972088	hsa-miR-1184	CLIP-seq
MIRT1972089	hsa-miR-1205	CLIP-seq
MIRT1972090	hsa-miR-1301	CLIP-seq
MIRT1972091	hsa-miR-3158-5p	CLIP-seq
MIRT1972092	hsa-miR-3545-3p	CLIP-seq
MIRT1972093	hsa-miR-4517	CLIP-seq
MIRT1972094	hsa-miR-4660	CLIP-seq
MIRT1972095	hsa-miR-4757-5p	CLIP-seq
MIRT1972096	hsa-miR-5047	CLIP-seq
MIRT2207914	hsa-miR-181a	CLIP-seq
MIRT2207915	hsa-miR-181b	CLIP-seq
MIRT2207916	hsa-miR-181c	CLIP-seq
MIRT2207917	hsa-miR-181d	CLIP-seq
MIRT2207918	hsa-miR-4262	CLIP-seq
MIRT2436544	hsa-miR-1237	CLIP-seq
MIRT2436545	hsa-miR-3155	CLIP-seq
MIRT2436546	hsa-miR-3155b	CLIP-seq
MIRT2436547	hsa-miR-3622b-5p	CLIP-seq
MIRT2436548	hsa-miR-4268	CLIP-seq
MIRT2436549	hsa-miR-4287	CLIP-seq
MIRT2436550	hsa-miR-4684-3p	CLIP-seq
MIRT2436551	hsa-miR-4685-3p	CLIP-seq
MIRT2436552	hsa-miR-4691-5p	CLIP-seq
MIRT2436553	hsa-miR-484	CLIP-seq
MIRT2436554	hsa-miR-516a-3p	CLIP-seq
MIRT1972088	hsa-miR-1184	CLIP-seq
MIRT2511174	hsa-miR-1197	CLIP-seq
MIRT1972089	hsa-miR-1205	CLIP-seq
MIRT2511175	hsa-miR-1273e	CLIP-seq
MIRT2511176	hsa-miR-128	CLIP-seq
MIRT1972090	hsa-miR-1301	CLIP-seq
MIRT2511177	hsa-miR-1305	CLIP-seq
MIRT2511178	hsa-miR-141	CLIP-seq
MIRT2207914	hsa-miR-181a	CLIP-seq
MIRT2207915	hsa-miR-181b	CLIP-seq
MIRT2207916	hsa-miR-181c	CLIP-seq
MIRT2207917	hsa-miR-181d	CLIP-seq
MIRT2511179	hsa-miR-186	CLIP-seq
MIRT2511180	hsa-miR-200a	CLIP-seq
MIRT2511181	hsa-miR-2116	CLIP-seq
MIRT2511182	hsa-miR-2682	CLIP-seq
MIRT2511183	hsa-miR-27a	CLIP-seq
MIRT2511184	hsa-miR-27b	CLIP-seq
MIRT2511185	hsa-miR-3143	CLIP-seq
MIRT2511186	hsa-miR-3145-3p	CLIP-seq
MIRT2436545	hsa-miR-3155	CLIP-seq
MIRT2436546	hsa-miR-3155b	CLIP-seq
MIRT1972091	hsa-miR-3158-5p	CLIP-seq
MIRT2511187	hsa-miR-3163	CLIP-seq
MIRT2511188	hsa-miR-3168	CLIP-seq
MIRT2511189	hsa-miR-3170	CLIP-seq
MIRT2511190	hsa-miR-3187-3p	CLIP-seq
MIRT2511191	hsa-miR-3194-5p	CLIP-seq
MIRT2511192	hsa-miR-331-3p	CLIP-seq
MIRT1972092	hsa-miR-3545-3p	CLIP-seq
MIRT2511193	hsa-miR-3607-3p	CLIP-seq
MIRT2511194	hsa-miR-3613-3p	CLIP-seq
MIRT2511195	hsa-miR-3617	CLIP-seq
MIRT2511196	hsa-miR-3622a-5p	CLIP-seq
MIRT2436547	hsa-miR-3622b-5p	CLIP-seq
MIRT2511197	hsa-miR-3652	CLIP-seq
MIRT2511198	hsa-miR-3662	CLIP-seq
MIRT2511199	hsa-miR-3665	CLIP-seq
MIRT2511200	hsa-miR-3671	CLIP-seq
MIRT2511201	hsa-miR-369-3p	CLIP-seq
MIRT2511202	hsa-miR-3714	CLIP-seq
MIRT2511203	hsa-miR-374a	CLIP-seq
MIRT2511204	hsa-miR-374b	CLIP-seq
MIRT2511205	hsa-miR-3927	CLIP-seq
MIRT2511206	hsa-miR-3944-5p	CLIP-seq
MIRT2511207	hsa-miR-409-3p	CLIP-seq
MIRT2511208	hsa-miR-421	CLIP-seq
MIRT2207918	hsa-miR-4262	CLIP-seq
MIRT2436548	hsa-miR-4268	CLIP-seq
MIRT2436549	hsa-miR-4287	CLIP-seq
MIRT2511209	hsa-miR-4297	CLIP-seq
MIRT2511210	hsa-miR-4302	CLIP-seq
MIRT2511211	hsa-miR-4423-3p	CLIP-seq
MIRT2511212	hsa-miR-4424	CLIP-seq
MIRT2511213	hsa-miR-4430	CLIP-seq
MIRT2511214	hsa-miR-4434	CLIP-seq
MIRT2511215	hsa-miR-4435	CLIP-seq
MIRT2511216	hsa-miR-4451	CLIP-seq
MIRT2511217	hsa-miR-449c	CLIP-seq
MIRT2511218	hsa-miR-4505	CLIP-seq
MIRT2511219	hsa-miR-4516	CLIP-seq
MIRT1972093	hsa-miR-4517	CLIP-seq
MIRT2511220	hsa-miR-4529-5p	CLIP-seq
MIRT2511221	hsa-miR-4531	CLIP-seq
MIRT2511222	hsa-miR-4633-5p	CLIP-seq
MIRT2511223	hsa-miR-4637	CLIP-seq
MIRT1972094	hsa-miR-4660	CLIP-seq
MIRT2436550	hsa-miR-4684-3p	CLIP-seq
MIRT2436551	hsa-miR-4685-3p	CLIP-seq
MIRT2436552	hsa-miR-4691-5p	CLIP-seq
MIRT2511224	hsa-miR-4695-3p	CLIP-seq
MIRT2511225	hsa-miR-4701-5p	CLIP-seq
MIRT2511226	hsa-miR-4720-5p	CLIP-seq
MIRT2511227	hsa-miR-4724-3p	CLIP-seq
MIRT1972095	hsa-miR-4757-5p	CLIP-seq
MIRT2511228	hsa-miR-4773	CLIP-seq
MIRT2511229	hsa-miR-4799-3p	CLIP-seq
MIRT2511230	hsa-miR-4803	CLIP-seq
MIRT2436553	hsa-miR-484	CLIP-seq
MIRT2511231	hsa-miR-487a	CLIP-seq
MIRT2511232	hsa-miR-489	CLIP-seq
MIRT1972096	hsa-miR-5047	CLIP-seq
MIRT2511233	hsa-miR-513b	CLIP-seq
MIRT2436554	hsa-miR-516a-3p	CLIP-seq
MIRT2511234	hsa-miR-520d-5p	CLIP-seq
MIRT2511235	hsa-miR-524-5p	CLIP-seq
MIRT2511236	hsa-miR-532-5p	CLIP-seq
MIRT2511237	hsa-miR-539	CLIP-seq
MIRT2511238	hsa-miR-543	CLIP-seq
MIRT2511239	hsa-miR-548a-3p	CLIP-seq
MIRT2511240	hsa-miR-548e	CLIP-seq
MIRT2511241	hsa-miR-548f	CLIP-seq
MIRT2511242	hsa-miR-548s	CLIP-seq
MIRT2511243	hsa-miR-561	CLIP-seq
MIRT2511244	hsa-miR-563	CLIP-seq
MIRT2511245	hsa-miR-570	CLIP-seq
MIRT2511246	hsa-miR-576-3p	CLIP-seq
MIRT2511247	hsa-miR-588	CLIP-seq
MIRT2511248	hsa-miR-607	CLIP-seq
MIRT2511249	hsa-miR-641	CLIP-seq
MIRT2511250	hsa-miR-648	CLIP-seq
MIRT2511251	hsa-miR-657	CLIP-seq
MIRT2511252	hsa-miR-935	CLIP-seq
MIRT2511253	hsa-miR-944	CLIP-seq
MIRT1972088	hsa-miR-1184	CLIP-seq
MIRT2511174	hsa-miR-1197	CLIP-seq
MIRT1972089	hsa-miR-1205	CLIP-seq
MIRT2436544	hsa-miR-1237	CLIP-seq
MIRT2678849	hsa-miR-1238	CLIP-seq
MIRT2511175	hsa-miR-1273e	CLIP-seq
MIRT2511176	hsa-miR-128	CLIP-seq
MIRT1972090	hsa-miR-1301	CLIP-seq
MIRT2511177	hsa-miR-1305	CLIP-seq
MIRT2207914	hsa-miR-181a	CLIP-seq
MIRT2207915	hsa-miR-181b	CLIP-seq
MIRT2207916	hsa-miR-181c	CLIP-seq
MIRT2207917	hsa-miR-181d	CLIP-seq
MIRT2511179	hsa-miR-186	CLIP-seq
MIRT2678850	hsa-miR-205	CLIP-seq
MIRT2511181	hsa-miR-2116	CLIP-seq
MIRT2511183	hsa-miR-27a	CLIP-seq
MIRT2511184	hsa-miR-27b	CLIP-seq
MIRT2678851	hsa-miR-3124-3p	CLIP-seq
MIRT2511185	hsa-miR-3143	CLIP-seq
MIRT2511186	hsa-miR-3145-3p	CLIP-seq
MIRT2436545	hsa-miR-3155	CLIP-seq
MIRT2436546	hsa-miR-3155b	CLIP-seq
MIRT1972091	hsa-miR-3158-5p	CLIP-seq
MIRT2511187	hsa-miR-3163	CLIP-seq
MIRT2511188	hsa-miR-3168	CLIP-seq
MIRT2511189	hsa-miR-3170	CLIP-seq
MIRT2511190	hsa-miR-3187-3p	CLIP-seq
MIRT2511191	hsa-miR-3194-5p	CLIP-seq
MIRT2511192	hsa-miR-331-3p	CLIP-seq
MIRT1972092	hsa-miR-3545-3p	CLIP-seq
MIRT2511194	hsa-miR-3613-3p	CLIP-seq
MIRT2436547	hsa-miR-3622b-5p	CLIP-seq
MIRT2511197	hsa-miR-3652	CLIP-seq
MIRT2511198	hsa-miR-3662	CLIP-seq
MIRT2511199	hsa-miR-3665	CLIP-seq
MIRT2511200	hsa-miR-3671	CLIP-seq
MIRT2511201	hsa-miR-369-3p	CLIP-seq
MIRT2511203	hsa-miR-374a	CLIP-seq
MIRT2511204	hsa-miR-374b	CLIP-seq
MIRT2678852	hsa-miR-3918	CLIP-seq
MIRT2511205	hsa-miR-3927	CLIP-seq
MIRT2511206	hsa-miR-3944-5p	CLIP-seq
MIRT2511207	hsa-miR-409-3p	CLIP-seq
MIRT2511208	hsa-miR-421	CLIP-seq
MIRT2207918	hsa-miR-4262	CLIP-seq
MIRT2436548	hsa-miR-4268	CLIP-seq
MIRT2436549	hsa-miR-4287	CLIP-seq
MIRT2511209	hsa-miR-4297	CLIP-seq
MIRT2511210	hsa-miR-4302	CLIP-seq
MIRT2511212	hsa-miR-4424	CLIP-seq
MIRT2511213	hsa-miR-4430	CLIP-seq
MIRT2511214	hsa-miR-4434	CLIP-seq
MIRT2511215	hsa-miR-4435	CLIP-seq
MIRT2511216	hsa-miR-4451	CLIP-seq
MIRT2511218	hsa-miR-4505	CLIP-seq
MIRT2678853	hsa-miR-4512	CLIP-seq
MIRT2511219	hsa-miR-4516	CLIP-seq
MIRT1972093	hsa-miR-4517	CLIP-seq
MIRT2511220	hsa-miR-4529-5p	CLIP-seq
MIRT2511221	hsa-miR-4531	CLIP-seq
MIRT2511223	hsa-miR-4637	CLIP-seq
MIRT1972094	hsa-miR-4660	CLIP-seq
MIRT2436550	hsa-miR-4684-3p	CLIP-seq
MIRT2436551	hsa-miR-4685-3p	CLIP-seq
MIRT2678854	hsa-miR-4691-3p	CLIP-seq
MIRT2436552	hsa-miR-4691-5p	CLIP-seq
MIRT2511224	hsa-miR-4695-3p	CLIP-seq
MIRT2511225	hsa-miR-4701-5p	CLIP-seq
MIRT2678855	hsa-miR-4711-3p	CLIP-seq
MIRT2511226	hsa-miR-4720-5p	CLIP-seq
MIRT2511227	hsa-miR-4724-3p	CLIP-seq
MIRT2678856	hsa-miR-4753-3p	CLIP-seq
MIRT1972095	hsa-miR-4757-5p	CLIP-seq
MIRT2511228	hsa-miR-4773	CLIP-seq
MIRT2511229	hsa-miR-4799-3p	CLIP-seq
MIRT2511230	hsa-miR-4803	CLIP-seq
MIRT2436553	hsa-miR-484	CLIP-seq
MIRT2511231	hsa-miR-487a	CLIP-seq
MIRT2511232	hsa-miR-489	CLIP-seq
MIRT1972096	hsa-miR-5047	CLIP-seq
MIRT2511233	hsa-miR-513b	CLIP-seq
MIRT2436554	hsa-miR-516a-3p	CLIP-seq
MIRT2511234	hsa-miR-520d-5p	CLIP-seq
MIRT2511235	hsa-miR-524-5p	CLIP-seq
MIRT2511237	hsa-miR-539	CLIP-seq
MIRT2511238	hsa-miR-543	CLIP-seq
MIRT2511242	hsa-miR-548s	CLIP-seq
MIRT2511243	hsa-miR-561	CLIP-seq
MIRT2511244	hsa-miR-563	CLIP-seq
MIRT2511245	hsa-miR-570	CLIP-seq
MIRT2511246	hsa-miR-576-3p	CLIP-seq
MIRT2511247	hsa-miR-588	CLIP-seq
MIRT2678857	hsa-miR-593	CLIP-seq
MIRT2678858	hsa-miR-603	CLIP-seq
MIRT2511248	hsa-miR-607	CLIP-seq
MIRT2511250	hsa-miR-648	CLIP-seq
MIRT2511251	hsa-miR-657	CLIP-seq
MIRT2678859	hsa-miR-873	CLIP-seq
MIRT2511252	hsa-miR-935	CLIP-seq

Show/Hide all (10)

Transcription factor	Regulation	Reference
BRCA1	Repression	22120723
CEBPD	Activation	23028973
GATA3	Repression	22120723
HMGA1	Unknown	11112786;7479086
NFKB1	Activation	10530453;15958549
NFKB1	Unknown	11112786;16040075;7479086
PARP1	Unknown	11112786
RELA	Activation	10530453;15958549
RELA	Unknown	11112786;16040075
SP1	Unknown	11112786;7479086

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	9079638, 10820279
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	10881932
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10820279
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	9725262
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	9725262, 10820279
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10820279
GO:0007399	Process	Nervous system development	TAS	9058825
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10820279
GO:0008047	Function	Enzyme activator activity	TAS	9079638
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8380167
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9551928
GO:0030036	Process	Actin cytoskeleton organization	TAS	9725262
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0035556	Process	Intracellular signal transduction	TAS	9551928
GO:0035580	Component	Specific granule lumen	TAS
GO:0060326	Process	Cell chemotaxis	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:1904724	Component	Tertiary granule lumen	TAS

MIM	HGNC	e!Ensembl
155730	4602	ENSG00000163739

P09341

Protein name

Growth-regulated alpha protein (C-X-C motif chemokine 1) (GRO-alpha(1-73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil-activating protein 3) (NAP-3) [Cleaved into: GRO-alpha(4-73); GRO-alpha(5-73); GRO-alpha(6-73)]

Protein function

Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold high

PDB

1MGS , 1MSG , 1MSH , 1ROD , 8K4O , 8XWA , 8XWV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	41 → 100	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Sequence

MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Sequence length

107

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway NF-kappa B signaling pathway NOD-like receptor signaling pathway IL-17 signaling pathway TNF signaling pathway Alcoholic liver disease Epithelial cell signaling in Helicobacter pylori infection Legionellosis Amoebiasis Kaposi sarcoma-associated herpesvirus infection Rheumatoid arthritis Lipid and atherosclerosis		Chemokine receptors bind chemokines G alpha (i) signalling events Interleukin-10 signaling Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (227)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acne Vulgaris	Associate	31281837	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Associate	30514120	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Febrile Encephalopathy	Stimulate	15608388	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Injury	Associate	23511138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	34269159, 34724890	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	21249124, 23155391	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alcoholic Neuropathy	Stimulate	17594598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Inhibit	23502337	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Associate	26345899	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	38178159, 40613333	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Associate	28437540	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Associate	39991758	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Associate	28012239, 34963488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Associate	10086850, 1732389, 35055107, 9424095	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Stimulate	8245503	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	10337033, 10437780, 28850672	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	18205922, 28708839, 33066816, 33087182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ascites	Associate	31039761	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Associate	18774390, 20371397, 34727921, 36197221	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Stimulate	19017877	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Inhibit	40696647	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Associate	32383373	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Squamous Cells of the Cervix	Associate	29887999	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bacteremia	Associate	39966757	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Associate	24894780	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	18045955, 18248671, 19451693, 25344051, 29495008, 36581948, 39287311	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	20030852, 39518934	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	28560447, 31322183	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans Syndrome	Associate	25828101	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	35940046	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	11371564, 17060621, 23815949, 29784873, 34218518	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Stimulate	25485576	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	24260493, 26503598, 29962817, 36411463, 36975480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Inhibit	36938723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	21298036	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	32481352, 37540227, 37622107	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	23890481	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	36035865	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Associate	28637660	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Associate	18205922, 31981738	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cell Transformation Neoplastic	Associate	31637480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	31183363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Associate	24619879	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cheilitis glandularis	Stimulate	28285559	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	35377900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Inhibit	35218958	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Associate	30760334	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Associate	30227886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	32190668, 33462173, 34717557, 36854781, 38070204	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	32788867, 34473751, 35958781, 36246978, 38031087	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Associate	38297356	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	16101183, 18578857, 19957108, 21285972, 23155391, 26208990, 27091625, 27472713, 29784873, 30973890, 31137244, 31893510, 32058945, 32351322, 32462020 View all (8 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	32337262, 34233297, 36434686	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	19957108	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	12871498	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cough	Associate	28842514	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	33726831, 34020127, 34582497	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Stimulate	34262555, 34413339	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Associate	28859336	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	27267052, 34106269, 37496049, 39475676	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Associate	19399182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Associate	30905425	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Associate	33848079	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Stimulate	36045687	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Stimulate	17594598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Associate	26171980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Stimulate	39408763	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	22272250, 25315214, 27304428	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Stimulate	31892708	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	39966757	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	35381625	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	40127075	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Associate	24619879	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	32778679, 37986381, 38206700	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Associate	17594598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Associate	30227886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Associate	37717172	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocarditis	Associate	25776751	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	30475413	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometritis	Associate	20495539	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Associate	34269788	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Associate	39343172	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	34555062	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	28518141, 34218518, 34404882	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Associate	39440870	★★★★★ ★☆☆☆☆ Found in Text Mining only
Femoracetabular Impingement	Associate	23965695	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	24260493, 37266443	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Inhibit	26314558	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Stimulate	37268663	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Associate	40613333	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Associate	11091274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Associate	25120735	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	32534425, 33571109	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	30379898	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Associate	24023680	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Associate	14688376	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Associate	11112786	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Stimulate	9424095	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hand Foot and Mouth Disease	Associate	24367714	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Associate	39966757	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	29784904	★★★★★ ★☆☆☆☆ Found in Text Mining only
Helicobacter Infections	Stimulate	9659152	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Associate	35185912	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Associate	26314558	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Stimulate	33766512	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hip Injuries	Associate	23965695	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	12734381	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Stimulate	39595551	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pregnancy Induced	Inhibit	39503530	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Stimulate	25279550	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	20729179	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Stimulate	35043517	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis	Associate	27554821	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Noncirrhotic Portal Hypertension	Associate	24260493	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	32899090	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Vasculitis	Associate	15608388	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin Light chain Amyloidosis	Associate	32922167	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Stimulate	10023340, 34256007, 36131109	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	25404022	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	11115149, 11371564, 15008987, 17594598, 19376732, 19399182, 20962773, 21249124, 22503040, 23613363, 24778119, 24825356, 25766782, 2670560, 27163710 View all (30 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	31991796, 36131109	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	32020185, 38199515	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Neoplasms	Associate	18248671	★★★★★ ★☆☆☆☆ Found in Text Mining only
Influenza Human	Inhibit	9064338	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	35042389	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Stimulate	38297356	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	37540227	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	37554265	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	31409670	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Monocytic Acute	Associate	10765922	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Associate	40613333	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lichen Planus Oral	Associate	24581860	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Associate	24260493, 31637480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Associate	34367180	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	39619227	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Associate	31637480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	38158808	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Associate	37266432	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	23665907, 38158808	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	33685997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Stimulate	19155472	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	20731665, 27472713, 27748927, 28575019, 35377900, 38158808	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	30379898	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	22980495	★★★★★ ★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Associate	33314777	★★★★★ ★☆☆☆☆ Found in Text Mining only
MASS syndrome	Associate	21928244	★★★★★ ★☆☆☆☆ Found in Text Mining only
Measles	Stimulate	12808325	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Associate	32539808	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	11112213, 11773061, 1372901, 15899804, 16098041, 16799643, 20030852, 2217207, 22225770, 22441657, 25560632, 25944800, 2670560, 34799355, 35043517 View all (5 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Stimulate	11112786, 1732389, 30870978, 35538545, 7479086	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Inhibit	37481560	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	39566744	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Associate	31214186	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Associate	26462152, 34384424	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Associate	12808325, 15608388	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	25268740, 32922167	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Associate	28045063	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	31772617, 32594092, 33847684, 39809140	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Associate	40114239	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Stimulate	19178793	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	18045955, 18578857, 21343381, 22753015, 27091625, 27472713, 29784873, 35764974, 36810912	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	31500632, 32539808, 35940046, 40235059	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	12734381, 16799643, 18045955, 18578857, 19258312, 19957108, 20169105, 20731665, 21343381, 21483804, 21928244, 22893706, 23155391, 23665907, 23815949 View all (32 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	21131600, 21285972, 23890481	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	21298036, 29495008, 34020271, 34517533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Adipose Tissue	Associate	35894174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Associate	33579221	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Associate	34079083	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroinflammatory Diseases	Associate	37548929	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	32594092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Inhibit	29784904	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	29887999, 33487124, 35894174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Stimulate	10437780	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	12483724, 21134476, 25279550, 33087182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	17060621	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	17060621, 18719363, 21928244, 23300534, 24376747, 26462152, 27472713, 32326946, 32851734, 34995016, 35618786, 37787042	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Stimulate	34794429	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	27472713, 29157747	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peri Implantitis	Associate	36013591	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	34859622, 38206700	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Stimulate	35154475	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Associate	28575019	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonsillar Abscess	Associate	15008987	★★★★★ ★☆☆☆☆ Found in Text Mining only
Placenta Diseases	Associate	30402038	★★★★★ ★☆☆☆☆ Found in Text Mining only
Plaque Atherosclerotic	Stimulate	28637660	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pneumococcal Infections	Stimulate	12952922, 37358300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pneumonia	Associate	28381820	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	24279306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies Autoimmune	Associate	17223652	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post Acute COVID 19 Syndrome	Stimulate	38326527	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19388934, 20729179	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	31500632, 32339056, 39518934	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	1732389, 33416099, 36765431, 38003437, 38115636	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Associate	25970596	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	20395558, 30395484, 30676127, 34145303, 34335580, 36017119	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Associate	27352120, 30905425	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Stimulate	24903614	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Associate	25501066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Associate	36224527	★★★★★ ★☆☆☆☆ Found in Text Mining only
Radiation Pneumonitis	Associate	33109238	★★★★★ ★☆☆☆☆ Found in Text Mining only
Recombinant chromosome 8 syndrome	Stimulate	35618786	★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent respiratory papillomatosis	Associate	34669519	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Stimulate	37711613	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reperfusion Injury	Stimulate	33670793	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Perforations	Associate	33430811	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Associate	25766782	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Diseases	Associate	12483724	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	25301363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 4 autosomal dominant	Associate	9507385	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	18254958, 21085979, 26462152, 36328378	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	14632759, 21343381, 23815949, 27748927, 28575019, 29283424, 36614235	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stimulate	20731665	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Associate	38173028	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Associate	24903614	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tarlov Cysts	Associate	27472713	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Stimulate	24894780	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Associate	31801935	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia Neonatal Alloimmune	Associate	9163597	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	35515000	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tibial Meniscus Injuries	Inhibit	24315792	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonsillitis	Associate	15008987, 15807854	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Stimulate	28560447	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	28750689, 33959656, 35377948	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	23815949, 29854840, 30816487, 34517533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Stimulate	28285559	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	35264061, 35764974	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Associate	25766782	★★★★★ ★☆☆☆☆ Found in Text Mining only

CXCL1 (C-X-C motif chemokine ligand 1)