GRM8 (glutamate metabotropic receptor 8)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2918
Gene name Gene Name - the full gene name approved by the HGNC.
Glutamate metabotropic receptor 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GRM8
Synonyms (NCBI Gene) Gene synonyms aliases
GLUR8, GPRC1H, MGLUR8, mGlu8
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q31.33
Summary Summary of gene provided in NCBI Entrez Gene.
L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbe
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(17)
miRTarBase ID miRNA Experiments Reference
MIRT028921 hsa-miR-26b-5p Microarray 19088304
MIRT717828 hsa-miR-877-3p HITS-CLIP 19536157
MIRT717827 hsa-miR-7111-3p HITS-CLIP 19536157
MIRT717826 hsa-miR-6780a-3p HITS-CLIP 19536157
MIRT717825 hsa-miR-6881-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0001640 Function Adenylate cyclase inhibiting G protein-coupled glutamate receptor activity IBA 21873635
GO:0001642 Function Group III metabotropic glutamate receptor activity IBA 21873635
GO:0004930 Function G protein-coupled receptor activity IMP 9473604
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601116 4600 ENSG00000179603
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O00222
Protein name Metabotropic glutamate receptor 8 (mGluR8)
Protein function G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Si
PDB 6BSZ , 6BT5 , 6E5V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01094 ANF_receptor 74 → 480 Receptor family ligand binding region Family
PF07562 NCD3G 512 → 562 Nine Cysteines Domain of family 3 GPCR Family
PF00003 7tm_3 595 → 840 7 transmembrane sweet-taste receptor of 3 GCPR Family
Sequence 
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
Sequence length 908
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse 		  G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (5)
Causal
Disease term Disease name dbSNP ID References
Attention deficit hyperactivity disorder Attention Deficit Disorder, Attention deficit hyperactivity disorder rs786205019 22138692
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)		 12676915
Lung carcinoma Small cell carcinoma of lung rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)		 22941189
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137
Show/Hide Unknown Diseases (7)
Unknown
Disease term Disease name Evidence References Source
Neuroticism Neuroticism GWAS
Gastroesophageal Reflux Disease Gastroesophageal Reflux Disease GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Diabetes Diabetes GWAS
Show/Hide Text Mining Associations (16)
Associations from Text Mining
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 34220331
Alcoholism Associate 18618593
Antisocial Personality Disorder Associate 32299001
Attention Deficit Disorder with Hyperactivity Associate 22138692, 24985920, 34233526
Autism Spectrum Disorder Associate 23275889
Carcinoma Squamous Cell Associate 28177435
Cocaine Related Disorders Associate 32299001
Cutaneous Fistula Associate 32299001
Death Associate 34220331
Diabetes Mellitus Type 2 Associate 36494812