GRM8 (glutamate metabotropic receptor 8)

Gene

• Entrez ID: 2918
• Gene name: Glutamate metabotropic receptor 8
• Gene symbol: GRM8
• Synonyms (NCBI Gene): GLUR8, GPRC1H, MGLUR8, mGlu8
• Chromosome: 7
• Chromosome location: 7q31.33
• Summary: L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbe

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028921	hsa-miR-26b-5p	Microarray	19088304
MIRT717828	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT717827	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT717826	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT717825	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT717824	hsa-miR-491-3p	HITS-CLIP	19536157
MIRT717828	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT717827	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT717826	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT717825	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT717824	hsa-miR-491-3p	HITS-CLIP	19536157
MIRT1035271	hsa-miR-2113	CLIP-seq
MIRT1035272	hsa-miR-3157-5p	CLIP-seq
MIRT1035273	hsa-miR-3663-5p	CLIP-seq
MIRT1035274	hsa-miR-4691-3p	CLIP-seq
MIRT1035275	hsa-miR-758	CLIP-seq
MIRT1035276	hsa-miR-885-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001642	Function	Group III metabotropic glutamate receptor activity	IBA
GO:0001642	Function	Group III metabotropic glutamate receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IMP	9473604
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9473604
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	11166323
GO:0007196	Process	Adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway	IEA
GO:0007196	Process	Adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway	IMP	9473604
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	IBA
GO:0007601	Process	Visual perception	TAS	9473604
GO:0008066	Function	Glutamate receptor activity	IEA
GO:0008066	Function	Glutamate receptor activity	IMP	9473604
GO:0016020	Component	Membrane	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IBA

Other IDs

• MIM: 601116
• HGNC: 4600
• e!Ensembl: ENSG00000179603

Protein

• UniProt ID: O00222
• Protein name: Metabotropic glutamate receptor 8 (mGluR8)
• Protein function: G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Si
• PDB: 6BSZ, 6BT5, 6E5V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01094	ANF_receptor	74 → 480	Receptor family ligand binding region	Family
  PF07562	NCD3G	512 → 562	Nine Cysteines Domain of family 3 GPCR	Family
  PF00003	7tm_3	595 → 840	7 transmembrane sweet-taste receptor of 3 GCPR	Family

• Sequence:

  MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
  GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
  QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
  PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
  EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
  GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
  EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
  KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
  KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
  CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
  VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC
  FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
  IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
  KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
  IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
  ISYSNHSI

• Sequence length: 908

Pathways

KEGG:

Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse

Reactome:

G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Cervical cancer	Benign	rs61755398	RCV005938636
Clear cell carcinoma of kidney	Benign	rs61755398	RCV005938637
Colon adenocarcinoma	Benign	rs61755398	RCV005938634
GRM8-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	rs61755398, rs769201, rs1237212020, rs140863337, rs568174461, rs61753365, rs17866780, rs769202, rs769194, rs769200, rs139046504, rs112220743	RCV003919702 RCV003911415 RCV003942010 RCV003941634 RCV003939623 RCV003978158 RCV003978298 RCV003925897 RCV003913263 RCV003936031 RCV003948352 RCV003968247
Lung cancer	Benign	rs61755398	RCV005938639
Melanoma	Uncertain significance	rs766834766	RCV005932500
Nonpapillary renal cell carcinoma	Benign	rs61755398	RCV005938635
Prostate cancer	Uncertain significance	rs139289550	RCV000149006
Sarcoma	Benign	rs61755398	RCV005938638

Associations from Text Mining
Disease Name	Relationship Type	References
Adrenocortical Carcinoma	Associate	34220331
Alcoholism	Associate	18618593
Antisocial Personality Disorder	Associate	32299001
Attention Deficit Disorder with Hyperactivity	Associate	22138692, 24985920, 34233526
Autism Spectrum Disorder	Associate	23275889
Carcinoma Squamous Cell	Associate	28177435
Cocaine Related Disorders	Associate	32299001
Cutaneous Fistula	Associate	32299001
Death	Associate	34220331
Diabetes Mellitus Type 2	Associate	36494812
Endometrial Neoplasms	Associate	23028188
Neoplasms	Inhibit	23028188
Neoplasms	Associate	29753314
Neuroblastoma	Associate	29753314
Neurotoxicity Syndromes	Associate	29753314
Substance Related Disorders	Associate	32299001