GRM7 (glutamate metabotropic receptor 7)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 2917
Gene name Glutamate metabotropic receptor 7
Gene symbol GRM7
Synonyms (NCBI Gene)
GLUR7GPRC1GMGLU7MGLUR7NEDSHBAPPP1R87
Chromosome 3
Chromosome location 3p26.1
Summary L-glutamate is the major excitatory neurotransmitter in the central nervous system, and it activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be pert
SNPs SNP information provided by dbSNP.
3
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (3)
SNP ID Visualize variation Clinical significance Consequence
rs1114167298 T>C Likely-pathogenic Missense variant, upstream transcript variant, genic upstream transcript variant, non coding transcript variant, coding sequence variant
rs1114167300 C>T Likely-pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs1114167301 C>A,T Likely-pathogenic Missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
7
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (7)
miRTarBase ID miRNA Experiments Reference
MIRT000073 hsa-miR-34a-5p ReviewqRT-PCR 20388499
MIRT000073 hsa-miR-34a-5p ReviewqRT-PCR 20388499
MIRT000073 hsa-miR-34a-5p Reporter assay;Proteomics 21566225
MIRT1035267 hsa-miR-205 CLIP-seq
MIRT1035268 hsa-miR-3124-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
39
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (39)
GO ID Ontology Definition Evidence Reference
GO:0001642 Function Group III metabotropic glutamate receptor activity IBA
GO:0001642 Function Group III metabotropic glutamate receptor activity IDA 9144652, 9473604
GO:0001662 Process Behavioral fear response IMP 17167337
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005509 Function Calcium ion binding IDA 18599484
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604101 4599 ENSG00000196277
Protein Protein information from UniProt database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14831
Protein name Metabotropic glutamate receptor 7 (mGluR7)
Protein function G-protein coupled receptor activated by glutamate that regulates axon outgrowth through the MAPK-cAMP-PKA signaling pathway during neuronal development (PubMed:33500274). Ligand binding causes a conformation change that triggers signaling via gu
PDB 3MQ4 , 5C5C , 7EPC , 7EPD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01094 ANF_receptor 77 → 486 Receptor family ligand binding region Family
PF07562 NCD3G 519 → 569 Nine Cysteines Domain of family 3 GPCR Family
PF00003 7tm_3 602 → 847 7 transmembrane sweet-taste receptor of 3 GCPR Family
Tissue specificity TISSUE SPECIFICITY: Expressed in many areas of the brain, especially in the cerebral cortex, hippocampus, and cerebellum. Expression of GRM7 isoforms in non-neuronal tissues appears to be restricted to isoform 3 and isoform 4. {ECO:0000269|PubMed:12052533
Sequence 
MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
PAAKKKYVSYNNLVI
Sequence length 915
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse 		  G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
33
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (8)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Bilateral multifocal epileptiform discharges Pathogenic rs1697820592 RCV001089898
Brain atrophy Pathogenic rs1114167298 RCV000491187
Global developmental delay Pathogenic rs1114167298, rs1697820592 RCV000491187
RCV001089898
Hypoplasia of the corpus callosum Pathogenic rs1114167298 RCV000491187
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
GRM7-related disorder Benign; Likely benign rs3749380, rs149053611, rs150722276, rs555598605, rs201868190, rs369433440, rs781674511 RCV003980483
RCV003978504
RCV003903665
RCV003919180
RCV003939110
RCV003969238
RCV003954427
Hepatocellular carcinoma Benign rs342034 RCV005913006
Show/Hide Text Mining Associations (37)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 26083657
Age Related Hearing Impairment 1 Associate 20068591, 24146964, 29455378, 30100543
Alzheimer Disease Associate 32694537
Anxiety Associate 21368711
Anxiety Disorders Associate 23295062
Atrophy Associate 32286009, 34273994
Attention Deficit Disorder with Hyperactivity Associate 22138692, 23295062, 37964012
Autism Spectrum Disorder Associate 31707215
Bipolar Disorder Associate 24804643, 27063557
Breast Neoplasms Associate 21688152