CD274 (CD274 molecule)

Gene

• Entrez ID: 29126
• Gene name: CD274 molecule
• Gene symbol: CD274
• Synonyms (NCBI Gene): ADMIO5, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1LG1, PDL1, hPD-L1
• Chromosome: 9
• Chromosome location: 9p24.1
• Summary: This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003923	hsa-miR-513a-5p	Luciferase reporter assay, Western blot	19155478
MIRT003923	hsa-miR-513a-5p	Luciferase reporter assay, Western blot	19155478
MIRT027156	hsa-miR-103a-3p	Sequencing	20371350
MIRT031920	hsa-miR-16-5p	Sequencing	20371350
MIRT053484	hsa-miR-570-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR	22190470
MIRT053484	hsa-miR-570-3p	Luciferase reporter assay	23430453
MIRT438407	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438406	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438405	hsa-miR-363-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438404	hsa-miR-326	Luciferase reporter assay, qRT-PCR	24577056
MIRT438403	hsa-miR-940	Luciferase reporter assay, qRT-PCR	24577056
MIRT438402	hsa-miR-665	Luciferase reporter assay, qRT-PCR	24577056
MIRT438401	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438400	hsa-miR-708-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438399	hsa-miR-601	Luciferase reporter assay, qRT-PCR	24577056
MIRT438398	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438397	hsa-miR-380-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438396	hsa-miR-885-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438395	hsa-miR-593-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438407	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438406	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438405	hsa-miR-363-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438404	hsa-miR-326	Luciferase reporter assay, qRT-PCR	24577056
MIRT438403	hsa-miR-940	Luciferase reporter assay, qRT-PCR	24577056
MIRT438402	hsa-miR-665	Luciferase reporter assay, qRT-PCR	24577056
MIRT438401	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438400	hsa-miR-708-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438399	hsa-miR-601	Luciferase reporter assay, qRT-PCR	24577056
MIRT438398	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438397	hsa-miR-380-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438396	hsa-miR-885-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438395	hsa-miR-593-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT732233	hsa-miR-138-5p	Luciferase reporter assay, Western blot	27248318
MIRT732233	hsa-miR-138-5p	Luciferase reporter assay, Western blot	27248318
MIRT031920	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT733233	hsa-miR-377-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	32550825
MIRT438398	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33821473
MIRT031920	hsa-miR-16-5p	Luciferase reporter assay, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	33330451
MIRT735524	hsa-let-7d-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry, ELISA	32746878
MIRT736542	hsa-miR-320a	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR	32929059
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT756213	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR	36352176
MIRT874428	hsa-miR-1224-5p	CLIP-seq
MIRT874429	hsa-miR-15a	CLIP-seq
MIRT874430	hsa-miR-15b	CLIP-seq
MIRT874431	hsa-miR-16	CLIP-seq
MIRT874432	hsa-miR-195	CLIP-seq
MIRT874433	hsa-miR-3117-5p	CLIP-seq
MIRT874434	hsa-miR-3146	CLIP-seq
MIRT874435	hsa-miR-339-5p	CLIP-seq
MIRT874436	hsa-miR-362-5p	CLIP-seq
MIRT874437	hsa-miR-3670	CLIP-seq
MIRT874438	hsa-miR-3915	CLIP-seq
MIRT874439	hsa-miR-410	CLIP-seq
MIRT874440	hsa-miR-424	CLIP-seq
MIRT874441	hsa-miR-4287	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT874443	hsa-miR-4469	CLIP-seq
MIRT874444	hsa-miR-4685-3p	CLIP-seq
MIRT874445	hsa-miR-4689	CLIP-seq
MIRT874446	hsa-miR-4713-5p	CLIP-seq
MIRT874447	hsa-miR-4751	CLIP-seq
MIRT874448	hsa-miR-4793-5p	CLIP-seq
MIRT874449	hsa-miR-497	CLIP-seq
MIRT874450	hsa-miR-500b	CLIP-seq
MIRT874451	hsa-miR-501-5p	CLIP-seq
MIRT874452	hsa-miR-556-5p	CLIP-seq
MIRT874428	hsa-miR-1224-5p	CLIP-seq
MIRT874437	hsa-miR-3670	CLIP-seq
MIRT874438	hsa-miR-3915	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT874445	hsa-miR-4689	CLIP-seq
MIRT874447	hsa-miR-4751	CLIP-seq
MIRT874452	hsa-miR-556-5p	CLIP-seq
MIRT2196298	hsa-miR-1207-3p	CLIP-seq
MIRT2196299	hsa-miR-1228	CLIP-seq
MIRT2196300	hsa-miR-138	CLIP-seq
MIRT2196301	hsa-miR-141	CLIP-seq
MIRT2196302	hsa-miR-200a	CLIP-seq
MIRT2196303	hsa-miR-2115	CLIP-seq
MIRT874433	hsa-miR-3117-5p	CLIP-seq
MIRT2196304	hsa-miR-3133	CLIP-seq
MIRT2196305	hsa-miR-377	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT2196306	hsa-miR-4694-3p	CLIP-seq
MIRT2196307	hsa-miR-4718	CLIP-seq
MIRT2196308	hsa-miR-516a-3p	CLIP-seq
MIRT874428	hsa-miR-1224-5p	CLIP-seq
MIRT874437	hsa-miR-3670	CLIP-seq
MIRT874438	hsa-miR-3915	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT874445	hsa-miR-4689	CLIP-seq
MIRT874447	hsa-miR-4751	CLIP-seq
MIRT2385728	hsa-miR-489	CLIP-seq
MIRT874452	hsa-miR-556-5p	CLIP-seq
MIRT2196298	hsa-miR-1207-3p	CLIP-seq
MIRT2196303	hsa-miR-2115	CLIP-seq
MIRT2196307	hsa-miR-4718	CLIP-seq
MIRT2196308	hsa-miR-516a-3p	CLIP-seq
MIRT2499288	hsa-miR-105	CLIP-seq
MIRT2499289	hsa-miR-1183	CLIP-seq
MIRT2196299	hsa-miR-1228	CLIP-seq
MIRT2499290	hsa-miR-1258	CLIP-seq
MIRT2499291	hsa-miR-1267	CLIP-seq
MIRT2499292	hsa-miR-148a	CLIP-seq
MIRT2499293	hsa-miR-148b	CLIP-seq
MIRT2499294	hsa-miR-151-3p	CLIP-seq
MIRT2499295	hsa-miR-152	CLIP-seq
MIRT2499296	hsa-miR-185	CLIP-seq
MIRT2499297	hsa-miR-193a-5p	CLIP-seq
MIRT2499298	hsa-miR-28-5p	CLIP-seq
MIRT2499299	hsa-miR-3117-3p	CLIP-seq
MIRT2499300	hsa-miR-3139	CLIP-seq
MIRT2499301	hsa-miR-3169	CLIP-seq
MIRT2499302	hsa-miR-3173-3p	CLIP-seq
MIRT2499303	hsa-miR-3591-3p	CLIP-seq
MIRT2499304	hsa-miR-3620	CLIP-seq
MIRT2499305	hsa-miR-3664-5p	CLIP-seq
MIRT2499306	hsa-miR-4251	CLIP-seq
MIRT2499307	hsa-miR-4254	CLIP-seq
MIRT2499308	hsa-miR-4275	CLIP-seq
MIRT2499309	hsa-miR-4306	CLIP-seq
MIRT2499310	hsa-miR-4308	CLIP-seq
MIRT2499311	hsa-miR-4329	CLIP-seq
MIRT2499312	hsa-miR-4457	CLIP-seq
MIRT2499313	hsa-miR-4463	CLIP-seq
MIRT2499314	hsa-miR-4499	CLIP-seq
MIRT2499315	hsa-miR-4641	CLIP-seq
MIRT2499316	hsa-miR-4644	CLIP-seq
MIRT2499317	hsa-miR-4653-3p	CLIP-seq
MIRT2499318	hsa-miR-4693-5p	CLIP-seq
MIRT2499319	hsa-miR-4731-3p	CLIP-seq
MIRT2499320	hsa-miR-4759	CLIP-seq
MIRT2499321	hsa-miR-4801	CLIP-seq
MIRT2499322	hsa-miR-4803	CLIP-seq
MIRT2499323	hsa-miR-520d-5p	CLIP-seq
MIRT2499324	hsa-miR-524-5p	CLIP-seq
MIRT2499325	hsa-miR-580	CLIP-seq
MIRT2499326	hsa-miR-676	CLIP-seq
MIRT2499327	hsa-miR-708	CLIP-seq
MIRT2499328	hsa-miR-765	CLIP-seq
MIRT2499288	hsa-miR-105	CLIP-seq
MIRT2499289	hsa-miR-1183	CLIP-seq
MIRT2196299	hsa-miR-1228	CLIP-seq
MIRT2499298	hsa-miR-28-5p	CLIP-seq
MIRT2499300	hsa-miR-3139	CLIP-seq
MIRT2677661	hsa-miR-3153	CLIP-seq
MIRT2677662	hsa-miR-3926	CLIP-seq
MIRT2499308	hsa-miR-4275	CLIP-seq
MIRT2499312	hsa-miR-4457	CLIP-seq
MIRT2499318	hsa-miR-4693-5p	CLIP-seq
MIRT2499319	hsa-miR-4731-3p	CLIP-seq
MIRT2499321	hsa-miR-4801	CLIP-seq
MIRT2677663	hsa-miR-548s	CLIP-seq
MIRT2499327	hsa-miR-708	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	38377992
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	28813417
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IMP	28813410, 28813417
GO:0003713	Function	Transcription coactivator activity	IDA	32929201
GO:0005515	Function	Protein binding	IPI	18585785, 20587542, 21982860, 23417675, 26602187, 28813410, 28813417, 31000591
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	32929201
GO:0005654	Component	Nucleoplasm	IDA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	28813410, 28813417
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IDA	10581077
GO:0007165	Process	Signal transduction	IDA	10581077
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	10581077
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0031295	Process	T cell costimulation	IBA
GO:0031295	Process	T cell costimulation	IDA	10581077
GO:0031901	Component	Early endosome membrane	IDA	28813417
GO:0031901	Component	Early endosome membrane	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IMP	12538684, 24187568
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	12538684, 24187568
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	10581077
GO:0034097	Process	Response to cytokine	IDA	17489864
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	IDA	36232715
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042102	Process	Positive regulation of T cell proliferation	TAS	10581077
GO:0042130	Process	Negative regulation of T cell proliferation	IBA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046006	Process	Regulation of activated T cell proliferation	IMP	24187568, 25310899
GO:0046007	Process	Negative regulation of activated T cell proliferation	IMP	12538684
GO:0048018	Function	Receptor ligand activity	IDA	28813410, 28813417
GO:0050868	Process	Negative regulation of T cell activation	IDA	38377992
GO:0055038	Component	Recycling endosome membrane	IDA	28813417
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0070062	Component	Extracellular exosome	IDA	17076679
GO:0070232	Process	Regulation of T cell apoptotic process	IMP	25310899
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:1903556	Process	Negative regulation of tumor necrosis factor superfamily cytokine production	IMP	24187568
GO:1905399	Process	Regulation of activated CD4-positive, alpha-beta T cell apoptotic process	IDA	24187568
GO:1905404	Process	Positive regulation of activated CD8-positive, alpha-beta T cell apoptotic process	IDA	24187568
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IDA	24691993
GO:2001186	Process	Negative regulation of CD8-positive, alpha-beta T cell activation	IDA	28813417
GO:2001186	Process	Negative regulation of CD8-positive, alpha-beta T cell activation	IMP	28813410, 28813417

Other IDs

• MIM: 605402
• HGNC: 17635
• e!Ensembl: ENSG00000120217

Protein

• UniProt ID: Q9NZQ7
• Protein name: Programmed cell death 1 ligand 1 (PD-L1) (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD antigen CD274)
• Protein function: Plays a critical role in induction and maintenance of immune tolerance to self (PubMed:11015443, PubMed:28813410, PubMed:28813417, PubMed:31399419). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cell
• PDB: 3BIK, 3BIS, 3FN3, 3SBW, 4Z18, 4ZQK, 5C3T, 5GGT, 5GRJ, 5IUS, 5J89, 5J8O, 5JDR, 5JDS, 5N2D, 5N2F, 5NIU, 5O45, 5O4Y, 5X8L, 5X8M, 5XJ4, 5XXY, 6L8R, 6NM7, 6NM8, 6NNV, 6NOJ, 6NOS, 6NP9, 6PV9, 6R3K, 6RPG, 6VQN, 6YCR, 7BEA, 7C88, 7CZD, 7DCV, 7DY7, 7NLD, 7OUN, 7SJQ, 7TPS, 7UX5, 7UXO, 7UXP, 7UXQ, 7VUN, 7XAD, 7XAE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	22 → 131	Immunoglobulin V-set domain	Domain
  PF08205	C2-set_2	135 → 220	CD80-like C2-set immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. {ECO:0000269|PubMed:10581
• Sequence:

  MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
  DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
  ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
  TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
  LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET

• Sequence length: 290

Pathways

KEGG:

Cell adhesion molecules
PD-L1 expression and PD-1 checkpoint pathway in cancer

Reactome:

PD-1 signaling