Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29126
Gene name Gene Name - the full gene name approved by the HGNC.	CD274 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD274
Synonyms (NCBI Gene) Gene synonyms aliases	ADMIO5, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1LG1, PDL1, hPD-L1
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p24.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobu

Show/Hide all(202)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003923	hsa-miR-513a-5p	Luciferase reporter assay, Western blot	19155478
MIRT003923	hsa-miR-513a-5p	Luciferase reporter assay, Western blot	19155478
MIRT027156	hsa-miR-103a-3p	Sequencing	20371350
MIRT031920	hsa-miR-16-5p	Sequencing	20371350
MIRT053484	hsa-miR-570-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR	22190470
MIRT053484	hsa-miR-570-3p	Luciferase reporter assay	23430453
MIRT438407	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438406	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438405	hsa-miR-363-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438404	hsa-miR-326	Luciferase reporter assay, qRT-PCR	24577056
MIRT438403	hsa-miR-940	Luciferase reporter assay, qRT-PCR	24577056
MIRT438402	hsa-miR-665	Luciferase reporter assay, qRT-PCR	24577056
MIRT438401	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438400	hsa-miR-708-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438399	hsa-miR-601	Luciferase reporter assay, qRT-PCR	24577056
MIRT438398	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438397	hsa-miR-380-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438396	hsa-miR-885-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438395	hsa-miR-593-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438407	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438406	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438405	hsa-miR-363-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438404	hsa-miR-326	Luciferase reporter assay, qRT-PCR	24577056
MIRT438403	hsa-miR-940	Luciferase reporter assay, qRT-PCR	24577056
MIRT438402	hsa-miR-665	Luciferase reporter assay, qRT-PCR	24577056
MIRT438401	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438400	hsa-miR-708-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438399	hsa-miR-601	Luciferase reporter assay, qRT-PCR	24577056
MIRT438398	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438397	hsa-miR-380-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438396	hsa-miR-885-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438395	hsa-miR-593-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT732233	hsa-miR-138-5p	Luciferase reporter assay, Western blot	27248318
MIRT732233	hsa-miR-138-5p	Luciferase reporter assay, Western blot	27248318
MIRT031920	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT733233	hsa-miR-377-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	32550825
MIRT438398	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33821473
MIRT031920	hsa-miR-16-5p	Luciferase reporter assay, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	33330451
MIRT735524	hsa-let-7d-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry, ELISA	32746878
MIRT736542	hsa-miR-320a	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR	32929059
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT756213	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR	36352176
MIRT874428	hsa-miR-1224-5p	CLIP-seq
MIRT874429	hsa-miR-15a	CLIP-seq
MIRT874430	hsa-miR-15b	CLIP-seq
MIRT874431	hsa-miR-16	CLIP-seq
MIRT874432	hsa-miR-195	CLIP-seq
MIRT874433	hsa-miR-3117-5p	CLIP-seq
MIRT874434	hsa-miR-3146	CLIP-seq
MIRT874435	hsa-miR-339-5p	CLIP-seq
MIRT874436	hsa-miR-362-5p	CLIP-seq
MIRT874437	hsa-miR-3670	CLIP-seq
MIRT874438	hsa-miR-3915	CLIP-seq
MIRT874439	hsa-miR-410	CLIP-seq
MIRT874440	hsa-miR-424	CLIP-seq
MIRT874441	hsa-miR-4287	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT874443	hsa-miR-4469	CLIP-seq
MIRT874444	hsa-miR-4685-3p	CLIP-seq
MIRT874445	hsa-miR-4689	CLIP-seq
MIRT874446	hsa-miR-4713-5p	CLIP-seq
MIRT874447	hsa-miR-4751	CLIP-seq
MIRT874448	hsa-miR-4793-5p	CLIP-seq
MIRT874449	hsa-miR-497	CLIP-seq
MIRT874450	hsa-miR-500b	CLIP-seq
MIRT874451	hsa-miR-501-5p	CLIP-seq
MIRT874452	hsa-miR-556-5p	CLIP-seq
MIRT874428	hsa-miR-1224-5p	CLIP-seq
MIRT874437	hsa-miR-3670	CLIP-seq
MIRT874438	hsa-miR-3915	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT874445	hsa-miR-4689	CLIP-seq
MIRT874447	hsa-miR-4751	CLIP-seq
MIRT874452	hsa-miR-556-5p	CLIP-seq
MIRT2196298	hsa-miR-1207-3p	CLIP-seq
MIRT2196299	hsa-miR-1228	CLIP-seq
MIRT2196300	hsa-miR-138	CLIP-seq
MIRT2196301	hsa-miR-141	CLIP-seq
MIRT2196302	hsa-miR-200a	CLIP-seq
MIRT2196303	hsa-miR-2115	CLIP-seq
MIRT874433	hsa-miR-3117-5p	CLIP-seq
MIRT2196304	hsa-miR-3133	CLIP-seq
MIRT2196305	hsa-miR-377	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT2196306	hsa-miR-4694-3p	CLIP-seq
MIRT2196307	hsa-miR-4718	CLIP-seq
MIRT2196308	hsa-miR-516a-3p	CLIP-seq
MIRT874428	hsa-miR-1224-5p	CLIP-seq
MIRT874437	hsa-miR-3670	CLIP-seq
MIRT874438	hsa-miR-3915	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT874445	hsa-miR-4689	CLIP-seq
MIRT874447	hsa-miR-4751	CLIP-seq
MIRT2385728	hsa-miR-489	CLIP-seq
MIRT874452	hsa-miR-556-5p	CLIP-seq
MIRT2196298	hsa-miR-1207-3p	CLIP-seq
MIRT2196303	hsa-miR-2115	CLIP-seq
MIRT2196307	hsa-miR-4718	CLIP-seq
MIRT2196308	hsa-miR-516a-3p	CLIP-seq
MIRT2499288	hsa-miR-105	CLIP-seq
MIRT2499289	hsa-miR-1183	CLIP-seq
MIRT2196299	hsa-miR-1228	CLIP-seq
MIRT2499290	hsa-miR-1258	CLIP-seq
MIRT2499291	hsa-miR-1267	CLIP-seq
MIRT2499292	hsa-miR-148a	CLIP-seq
MIRT2499293	hsa-miR-148b	CLIP-seq
MIRT2499294	hsa-miR-151-3p	CLIP-seq
MIRT2499295	hsa-miR-152	CLIP-seq
MIRT2499296	hsa-miR-185	CLIP-seq
MIRT2499297	hsa-miR-193a-5p	CLIP-seq
MIRT2499298	hsa-miR-28-5p	CLIP-seq
MIRT2499299	hsa-miR-3117-3p	CLIP-seq
MIRT2499300	hsa-miR-3139	CLIP-seq
MIRT2499301	hsa-miR-3169	CLIP-seq
MIRT2499302	hsa-miR-3173-3p	CLIP-seq
MIRT2499303	hsa-miR-3591-3p	CLIP-seq
MIRT2499304	hsa-miR-3620	CLIP-seq
MIRT2499305	hsa-miR-3664-5p	CLIP-seq
MIRT2499306	hsa-miR-4251	CLIP-seq
MIRT2499307	hsa-miR-4254	CLIP-seq
MIRT2499308	hsa-miR-4275	CLIP-seq
MIRT2499309	hsa-miR-4306	CLIP-seq
MIRT2499310	hsa-miR-4308	CLIP-seq
MIRT2499311	hsa-miR-4329	CLIP-seq
MIRT2499312	hsa-miR-4457	CLIP-seq
MIRT2499313	hsa-miR-4463	CLIP-seq
MIRT2499314	hsa-miR-4499	CLIP-seq
MIRT2499315	hsa-miR-4641	CLIP-seq
MIRT2499316	hsa-miR-4644	CLIP-seq
MIRT2499317	hsa-miR-4653-3p	CLIP-seq
MIRT2499318	hsa-miR-4693-5p	CLIP-seq
MIRT2499319	hsa-miR-4731-3p	CLIP-seq
MIRT2499320	hsa-miR-4759	CLIP-seq
MIRT2499321	hsa-miR-4801	CLIP-seq
MIRT2499322	hsa-miR-4803	CLIP-seq
MIRT2499323	hsa-miR-520d-5p	CLIP-seq
MIRT2499324	hsa-miR-524-5p	CLIP-seq
MIRT2499325	hsa-miR-580	CLIP-seq
MIRT2499326	hsa-miR-676	CLIP-seq
MIRT2499327	hsa-miR-708	CLIP-seq
MIRT2499328	hsa-miR-765	CLIP-seq
MIRT2499288	hsa-miR-105	CLIP-seq
MIRT2499289	hsa-miR-1183	CLIP-seq
MIRT2196299	hsa-miR-1228	CLIP-seq
MIRT2499298	hsa-miR-28-5p	CLIP-seq
MIRT2499300	hsa-miR-3139	CLIP-seq
MIRT2677661	hsa-miR-3153	CLIP-seq
MIRT2677662	hsa-miR-3926	CLIP-seq
MIRT2499308	hsa-miR-4275	CLIP-seq
MIRT2499312	hsa-miR-4457	CLIP-seq
MIRT2499318	hsa-miR-4693-5p	CLIP-seq
MIRT2499319	hsa-miR-4731-3p	CLIP-seq
MIRT2499321	hsa-miR-4801	CLIP-seq
MIRT2677663	hsa-miR-548s	CLIP-seq
MIRT2499327	hsa-miR-708	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002845	Process	Positive regulation of tolerance induction to tumor cell	IMP	28813410, 28813417
GO:0005515	Function	Protein binding	IPI	18585785, 20587542, 21982860, 23417675, 28813410, 28813417, 31000591
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA	28813410, 28813417
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA	21873635
GO:0006955	Process	Immune response	IDA	10581077
GO:0007165	Process	Signal transduction	IDA	10581077
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	10581077
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016021	Component	Integral component of membrane	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0031295	Process	T cell costimulation	IBA	21873635
GO:0031295	Process	T cell costimulation	IDA	10581077
GO:0031295	Process	T cell costimulation	TAS
GO:0031901	Component	Early endosome membrane	IDA	28813417
GO:0032689	Process	Negative regulation of interferon-gamma production	IMP	12538684, 24187568
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	12538684, 24187568
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	10581077
GO:0034097	Process	Response to cytokine	IDA	17489864
GO:0042102	Process	Positive regulation of T cell proliferation	IBA	21873635
GO:0042102	Process	Positive regulation of T cell proliferation	TAS	10581077
GO:0042130	Process	Negative regulation of T cell proliferation	IBA	21873635
GO:0046006	Process	Regulation of activated T cell proliferation	IMP	24187568, 25310899
GO:0046007	Process	Negative regulation of activated T cell proliferation	IMP	12538684
GO:0055038	Component	Recycling endosome membrane	IDA	28813417
GO:0070062	Component	Extracellular exosome	IDA	17076679
GO:0070232	Process	Regulation of T cell apoptotic process	IMP	25310899
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA	21873635
GO:1901998	Process	Toxin transport	IEA
GO:1903556	Process	Negative regulation of tumor necrosis factor superfamily cytokine production	IMP	24187568
GO:1905399	Process	Regulation of activated CD4-positive, alpha-beta T cell apoptotic process	IDA	24187568
GO:1905404	Process	Positive regulation of activated CD8-positive, alpha-beta T cell apoptotic process	IDA	24187568
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IDA	24691993
GO:2001186	Process	Negative regulation of CD8-positive, alpha-beta T cell activation	IMP	28813410, 28813417

MIM	HGNC	e!Ensembl
605402	17635	ENSG00000120217

Protein

UniProt ID

Q9NZQ7

Protein name

Programmed cell death 1 ligand 1 (PD-L1) (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD antigen CD274)

Protein function

Plays a critical role in induction and maintenance of immune tolerance to self (PubMed:11015443, PubMed:28813410, PubMed:28813417, PubMed:31399419). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cell

PDB

3BIK , 3BIS , 3FN3 , 3SBW , 4Z18 , 4ZQK , 5C3T , 5GGT , 5GRJ , 5IUS , 5J89 , 5J8O , 5JDR , 5JDS , 5N2D , 5N2F , 5NIU , 5O45 , 5O4Y , 5X8L , 5X8M , 5XJ4 , 5XXY , 6L8R , 6NM7 , 6NM8 , 6NNV , 6NOJ , 6NOS , 6NP9 , 6PV9 , 6R3K , 6RPG , 6VQN , 6YCR , 7BEA , 7C88 , 7CZD , 7DCV , 7DY7 , 7NLD , 7OUN , 7SJQ , 7TPS , 7UX5 , 7UXO , 7UXP , 7UXQ , 7VUN , 7XAD , 7XAE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	22 → 131	Immunoglobulin V-set domain	Domain
PF08205	C2-set_2	135 → 220	CD80-like C2-set immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. {ECO:0000269|PubMed:10581

Sequence

MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET

Sequence length

290

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules PD-L1 expression and PD-1 checkpoint pathway in cancer		PD-1 signaling

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	27692344
Lymphoma	Lymphoma	rs11540652, rs1592119138, rs1592123162, rs1599367044	28736328

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Diabetes Mellitus	neonatal diabetes mellitus	GenCC
Hypothyroidism	Hypothyroidism	GWAS
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	GWAS

Show/Hide Text Mining Associations (741)

Disease Name	Relationship Type	References
Associations from Text Mining
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Associate	30783096
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	25550797, 34071045
Abortion Spontaneous	Associate	26261529
Achalasia Addisonianism Alacrimia syndrome	Associate	36088477
Acidemia isovaleric	Associate	30964601
Acidosis	Stimulate	35927628
Acquired Immunodeficiency Syndrome	Associate	12468426, 40450975
Acrocephalosyndactylia	Associate	32430334, 37499395
Actinic cheilitis	Associate	21442435, 35195152
Acute On Chronic Liver Failure	Associate	35502507
Addison Disease	Associate	24614117, 33365026
Adenocarcinoma	Stimulate	25009014, 28623908, 35139126, 37378912, 39623844
Adenocarcinoma	Associate	25349974, 26464688, 27056074, 27158757, 27252415, 27346415, 27775076, 27815126, 28059094, 28193529, 28289861, 28341226, 29036791, 29049375, 29155514 View all (72 more)
Adenocarcinoma Follicular	Associate	35818041
Adenocarcinoma Mucinous	Associate	32762373, 34479920, 35635229
Adenocarcinoma of Lung	Associate	25895031, 26349666, 26851185, 26954523, 27342566, 27346415, 27568346, 27687306, 27815126, 28104537, 28145884, 28201746, 28451792, 28727766, 28829153 View all (115 more)
Adenocarcinoma of Lung	Inhibit	32616892, 34250747
Adenocarcinoma of Lung	Stimulate	36197217, 36426899
Adenolymphoma	Associate	36683495
Adenoma	Stimulate	27655724
Adenoma	Associate	37424874
Adenoma Islet Cell	Stimulate	39235590
Adenoma Oxyphilic	Associate	33716974, 33797012
Adenoma Pleomorphic	Associate	30568128, 30860657, 32045109, 32702887, 33838468, 34128136, 34916402, 36169795, 39620217
Adenomatous Polyposis Coli	Associate	31142513, 34483031
Adrenal Insufficiency	Stimulate	34042092
Adrenocortical Carcinoma	Associate	38415841
Adrenocortical Carcinoma Pediatric	Associate	39633439
Agnosia	Associate	31723167
Agnosia	Stimulate	32002294
Aicardi Syndrome	Associate	40671151
AIDS Associated Nephropathy	Associate	38158315
Allergic Fungal Sinusitis	Stimulate	15961727
Alopecia Areata	Associate	25896390
Alopecia Neurologic Defects and Endocrinopathy Syndrome	Associate	32616532, 35115362
Ameloblastoma	Associate	35761436
Amyloidosis Primary Cutaneous	Associate	28504999
Andersen Syndrome	Associate	34257548
Anemia Hemolytic	Associate	32192573
Aneuploidy	Associate	33952700
Angina Stable	Associate	31924334, 35645132
Angioedemas Hereditary	Associate	31236065
Angiomyolipoma	Associate	19501877
Anodontia	Associate	27568346, 28264871, 32089413, 36005189, 36613564
Anodontia	Stimulate	33457080, 34042312, 38281914
Anorexia	Associate	35586668
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	34108971, 36769297
Anus Neoplasms	Associate	28334399, 28453692, 29700411
Aortic Aneurysm Thoracic	Associate	28245875
Appendiceal Neoplasms	Associate	30692096
Arthralgia	Associate	29489833, 35115362
Arthritis	Associate	34691053
Arthritis	Stimulate	37068331
Arthritis Psoriatic	Inhibit	27542294
Arthritis Rheumatoid	Associate	17323353, 24742142, 25433812, 29489833, 30140263, 33901179, 40243636
Arthritis Rheumatoid	Inhibit	30327652
Arthritis Rheumatoid	Stimulate	37958839
Asbestosis	Associate	34022844
Ascites	Associate	24297569, 27665539, 39358478
Asthma	Associate	32394602, 36804777, 37260034
Astrocytoma	Associate	28531337, 34507430, 36580017
Ataxia Telangiectasia	Stimulate	27564404
Ataxia Telangiectasia	Associate	28496056, 35619700
Atherosclerosis	Associate	34082770
Atrial Fibrillation	Associate	25810125, 35600045
Atypical Squamous Cells of the Cervix	Stimulate	37469254
Autoimmune Diseases	Associate	19828602, 26041877, 27617656, 28513984, 30325236, 32243638, 32616532, 33193306, 35615575, 35979531, 36917924, 37467751, 37930659
Autoimmune Diseases	Inhibit	27630241
Autoimmune Diseases of the Nervous System	Associate	19852844, 35131574, 40352922
Benign non infected urachal cyst	Stimulate	32448798
Biliary Tract Neoplasms	Associate	27780932, 32352498, 32461347, 32704067, 34907910, 35130881, 35137343, 35967452, 36123922, 36650632, 40414848
Bloom Syndrome	Associate	32073752
Body Weight	Inhibit	28974264
Bone Diseases	Inhibit	33239417
Bone Diseases	Associate	36231113
Bone Marrow Diseases	Associate	35610613
Bone Neoplasms	Associate	37993664
Brain Diseases	Associate	28881488, 35105689
Brain Diseases	Inhibit	32389639
Brain Injuries Traumatic	Associate	37348508
Brain Neoplasms	Associate	19028999, 26517811, 27502709, 30131293, 30451357, 30587623, 30681550, 31489465, 32017467, 32117271, 32859740, 33184096, 34021481, 34121347, 34503964 View all (11 more)
Brain Neoplasms	Inhibit	29524062
Brain Stem Neoplasms	Associate	32449246
Breast Diseases	Stimulate	37390260
Breast Neoplasms	Associate	16611412, 18294387, 18850006, 24551119, 24842267, 25527356, 25669979, 25897014, 26093818, 26317899, 26378017, 26527522, 26942414, 27117582, 27531819 View all (177 more)
Breast Neoplasms	Inhibit	30203045, 31552680, 36423363
Breast Neoplasms	Stimulate	31022191, 31825827
Breast Neoplasms Male	Associate	30519815, 36614261
Bronchiolitis Obliterans Syndrome	Associate	34489963
Burkitt Lymphoma	Associate	29695237
Burkitt Lymphoma	Stimulate	29946193
Buschke Lowenstein Tumor	Associate	38186053
Calcinosis	Associate	37905619
Calcinosis Cutis	Associate	16208700, 23785454, 30760860, 31439614, 31647026, 31829518, 31973911, 32388585, 32964058, 33239417, 33833050, 33915250, 34907653, 35341390, 36522476, 37378674, 40222200 View all (2 more)
Calcinosis Cutis	Stimulate	37131267
Cancer Pain	Associate	33000216
Carbamoyl Phosphate Synthase I Deficiency Disease	Associate	33278935, 38032149
Carcinogenesis	Associate	27683115, 28851898, 32373223, 32929059, 33980985, 34158547, 34240739, 34681840, 35499071, 35661198, 35818041, 36802389, 38597079
Carcinoid Tumor	Associate	28625622, 33037134
Carcinoma	Stimulate	28463396
Carcinoma	Associate	28671973, 28832074, 30031096, 32294103, 33155664, 33457085, 34103354, 34797780, 34949765, 34953041, 35204793, 37194064, 37926435, 40275321
Carcinoma Acinar Cell	Associate	30282880
Carcinoma Acinar Cell	Stimulate	36169795
Carcinoma Adenoid Cystic	Associate	29954240, 31990894, 36169795
Carcinoma Adenosquamous	Associate	28387300, 30407231, 31912675
Carcinoma Adenosquamous	Stimulate	28623908, 34841687
Carcinoma Adenosquamous	Inhibit	37545057
Carcinoma Basal Cell	Associate	28344809, 34121347, 38101862
Carcinoma Ductal	Associate	16611412, 29516978
Carcinoma Ductal Breast	Associate	29516978, 30085937, 35225058
Carcinoma Embryonal	Associate	26598537
Carcinoma Embryonal	Stimulate	28423520
Carcinoma Endometrioid	Associate	38148043
Carcinoma Hepatocellular	Associate	19058313, 19451266, 19826049, 21674477, 21853301, 21876620, 21912640, 22396772, 26084609, 26367730, 26968206, 27456947, 27966626, 28624577, 28627705 View all (112 more)
Carcinoma Hepatocellular	Inhibit	35226764
Carcinoma in Situ	Associate	17340590, 29073638, 40010639
Carcinoma Intraductal Noninfiltrating	Associate	26769139, 31375764, 32203210
Carcinoma Large Cell	Associate	28625622, 28925087, 29378266, 29713040, 33605014, 35144629, 35287068, 36263183, 38057657
Carcinoma Lobular	Associate	26729235, 28731046, 39388456
Carcinoma Medullary	Associate	26965581, 28807004, 31152546
Carcinoma Medullary	Stimulate	32857459
Carcinoma Merkel Cell	Associate	24416729, 25550797, 28373005, 30285852, 30993371, 31786889, 32324435, 32687503, 33361404, 34071045, 36683495, 37573372, 37851052, 38241371
Carcinoma Mucoepidermoid	Associate	36169795
Carcinoma Neuroendocrine	Associate	29037958, 29378266, 31011254, 31557757, 32727929, 36653904
Carcinoma Non Small Cell Lung	Associate	20514052, 21597388, 24162015, 24217091, 25009014, 25349974, 25597412, 25609202, 25658629, 25895031, 26317305, 26349666, 26361045, 26473645, 26483045 View all (604 more)
Carcinoma Non Small Cell Lung	Stimulate	24714771, 34254261
Carcinoma Non Small Cell Lung	Inhibit	34791815, 38186308
Carcinoma Ovarian Epithelial	Associate	26657115, 27864219, 27986748, 31105696, 31208449, 33580098, 33737722, 33804458, 34946254, 35031063, 36604635
Carcinoma Pancreatic Ductal	Stimulate	20976171
Carcinoma Pancreatic Ductal	Associate	26858311, 28007776, 28314962, 28602029, 28870260, 29066497, 29378617, 30031096, 30177687, 30426611, 31043417, 31284422, 32495519, 32580737, 33728352 View all (18 more)
Carcinoma Papillary	Associate	35238073, 35435364, 37558130
Carcinoma Renal Cell	Associate	15569934, 16208700, 16798883, 18355839, 18694993, 19296514, 19501877, 20208540, 20609235, 23676558, 24714771, 24778130, 24885059, 24926549, 25193987 View all (106 more)
Carcinoma Renal Cell	Stimulate	31130676, 31363159
Carcinoma Signet Ring Cell	Associate	28418918, 35042311
Carcinoma Small Cell	Associate	25582496, 27566252, 27639678, 28193529, 29378266, 29843803, 30735815, 31870883, 33457428, 33839362, 39623844
Carcinoma Small Cell	Stimulate	29577933
Carcinoma Squamous Cell	Associate	26313362, 27056074, 27103510, 27145277, 27158757, 27217541, 27562497, 27816392, 28008744, 28052400, 28059094, 28334399, 28341226, 28387300, 28453692 View all (79 more)
Carcinoma Squamous Cell	Stimulate	28623908, 31135485, 34384268, 34514576, 34841687, 34953041, 36333792, 36335353, 36503417
Carcinoma Squamous Cell	Inhibit	34250747
Carcinosarcoma	Associate	30101629, 34876047
Cardiomyopathies	Inhibit	28026044
Cardiomyopathy Dilated 1l	Associate	36564297
Cardiomyopathy infantile histiocytoid	Associate	38457034
Cardiomyopathy Restrictive	Stimulate	34489963
Cardiovascular Diseases	Associate	31924334, 32012411, 33009409, 34607896, 34668977, 34782426, 34935288, 36159840, 37839181, 38015220, 39333574
Carotid Stenosis	Associate	38172197
Celiac Disease	Stimulate	32066859
Celiac Disease	Associate	32581063, 34220824
Cell Transformation Neoplastic	Associate	32616706
Cerebral Palsy Ataxic Autosomal Recessive	Associate	35190375
Chagas Disease	Associate	34458163
Charcot Marie Tooth disease Type 1C	Associate	29378266, 35060518, 37999119
Charcot Marie Tooth disease Type 1C	Stimulate	32576238
Chemical and Drug Induced Liver Injury	Associate	35115362, 35615575
Cholangiocarcinoma	Associate	26373575, 27626174, 28445951, 30377340, 30419854, 30646854, 30773525, 30885276, 31367249, 31383016, 32653521, 33228682, 33239315, 33712681, 34526987 View all (19 more)
Cholangitis Sclerosing	Associate	35105689, 36341325
Chondrosarcoma	Associate	35204793
Chondrosarcoma Extraskeletal Myxoid	Associate	28832074
Chordoma	Associate	25349132, 25871477, 27172898, 29051990, 35145510
Choriocarcinoma	Associate	18550794, 26598537, 27158757
Chromosome Xp11.3 Deletion Syndrome	Associate	25193987, 28522811
Chronic Disease	Associate	38580043
Cicatrix Hypertrophic	Associate	36169254
Clear cell metastatic renal cell carcinoma	Associate	26424759, 27283319, 29566951, 30653744, 30837208, 31371341, 31651359, 34291367, 35240013, 35410325, 36451860, 36883235, 37498492, 37868689
Coinfection	Associate	32937024
Colitis	Associate	33130956, 35115362, 35427471
Colitis Associated Neoplasms	Inhibit	31048714
Colitis Ulcerative	Stimulate	27226337, 30864556
Colitis Ulcerative	Associate	34158547, 37273534
Colonic Diseases	Inhibit	36059511
Colonic Diseases	Associate	37999119
Colonic Neoplasms	Associate	26464688, 29284010, 30045644, 31983188, 31992245, 33625532, 33972391, 34060360, 35151825, 35773332, 36058633, 36849197
Colonic Polyps	Stimulate	31354723
Colorectal Neoplasms	Associate	22408358, 23785454, 23873101, 24124529, 25093496, 25583798, 27196573, 27404452, 27443512, 27552968, 27777774, 27813511, 28267224, 28405764, 28406723 View all (139 more)
Colorectal Neoplasms	Stimulate	27494857, 31354723, 31424670, 32358386, 35356153
Colorectal Neoplasms	Inhibit	37178411
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	29710228, 30723299, 33982365, 34275654
Common Variable Immunodeficiency	Associate	32575504, 33876323, 37997558
Communicable Diseases	Associate	28705256
Communication Disorders	Associate	37756307
Condylomata Acuminata	Associate	38186053
Congenital disorder of glycosylation type 1B	Associate	32093629
Congenital disorder of glycosylation type 1C	Associate	34625514
Conjunctival Diseases	Associate	31141610
Coronary Artery Disease	Associate	28604383, 30333306
Coronary Disease	Associate	33761687
Cough	Associate	33130956
COVID 19	Associate	33003471, 33138195, 33317616, 33452008, 33692788, 33737684, 33979758, 34080738, 34163490, 34330510, 35145507, 35222440, 35280992, 35301248, 35458548 View all (10 more)
COVID 19	Inhibit	36139476
Craniopharyngioma	Associate	29509940, 32958683, 40721446
Crohn Disease	Associate	22397822, 30544444, 31633754, 33570446, 39199011
Crohn Disease	Stimulate	32066859
Cross Infection	Associate	39684323
Cystic Fibrosis	Associate	25926674, 30442491
Cysts	Associate	29509940
Cytokine Release Syndrome	Associate	33667790
Deafness Autosomal Dominant 1	Stimulate	36575294
Death	Associate	20609235, 26952546, 27776338, 29063313, 31959726, 32291904, 33162477, 33579737, 34207794, 34449496, 34960725, 34973513, 35222440, 35427471, 36130991 View all (6 more)
Death	Inhibit	29769438, 35905672
Dendritic Cell Sarcoma Follicular	Stimulate	26110571
Dendritic Cell Sarcoma Follicular	Associate	26564005, 28130401, 37994105
Depressive Disorder	Associate	37092578
Dermatitis Atopic	Inhibit	32430334
Desmoid disease hereditary	Associate	34276259, 37098880
Diabetes Gestational	Associate	36513052
Diabetes Mellitus	Associate	28230773, 29513874, 35691098
Diabetes Mellitus Type 1	Associate	30269996, 30534571, 31949260, 32616532, 33365026, 36657987
Diabetes Mellitus Type 2	Associate	31008114
Diabetes Mellitus Type 2	Stimulate	34330510
Diabetes Mellitus Type 2	Inhibit	34429434
Diarrhea	Associate	27269937, 34102137, 35427471, 35586668
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	28438290, 35238073
Digestive System Diseases	Associate	29037958
Digestive System Neoplasms	Associate	34207794
Disease	Associate	27104612, 29440293, 30546030, 31959726, 33181636, 33402127, 36730339
Disease Progression	Associate	32221016, 34106609
Disease Progression	Stimulate	37349318
DNA Repair Deficiency Disorders	Associate	32376735
DNA Virus Infections	Stimulate	27707838
Down Syndrome	Associate	26801886
Drug Fever	Stimulate	34413168
Drug Related Side Effects and Adverse Reactions	Associate	21268005, 30901292, 32079038, 32830112, 34208001, 34407491, 34685495, 35013004, 35228614, 36105807, 36896779, 37148657, 39282109, 39828218, 40381506
Drug Related Side Effects and Adverse Reactions	Stimulate	34413168, 35115362
Duodenitis	Associate	32581063
Dyskinesias	Associate	36597662
Dysplastic Nevus Syndrome	Associate	26403783
Endometrial Neoplasms	Stimulate	24658839
Endometrial Neoplasms	Associate	28264871, 28347512, 28358435, 28752845, 29053481, 29559741, 30291344, 30401949, 30539847, 30640692, 31370215, 31973911, 32066405, 32376735, 33972391 View all (20 more)
Endometriosis	Associate	30325236, 30595667, 33078970, 34656305, 36232911
Enteritis	Associate	22397822, 35172862
Ependymoma	Associate	29350470, 30483834, 40238025
Epidermal Cyst	Associate	39427497
Epidermodysplasia Verruciformis	Associate	32080744, 37084607
Epidermolysis Bullosa Dystrophica	Associate	33637494
Epstein Barr Virus Infections	Stimulate	22271878, 25361008, 27807760, 29946193, 31790410, 32002294, 33457080, 33479394
Epstein Barr Virus Infections	Associate	22661084, 27147580, 27626174, 29155997, 30683910, 31481499, 32273478, 35734348, 35842661, 36827173, 38422689
Erdheim Chester Disease	Stimulate	26110571
Ermine phenotype	Associate	27566252
Esophageal Neoplasms	Associate	25337246, 26761210, 27015293, 28848143, 29116900, 31519770, 32500232, 33793074, 34067485, 34693652, 34814273, 34953041, 34973513, 35107757, 35435118 View all (7 more)
Esophageal Neoplasms	Stimulate	33290281
Esophageal Squamous Cell Carcinoma	Associate	26761210, 27120796, 27322149, 27729745, 28039448, 28192623, 28294486, 28404915, 28657901, 28949934, 29060926, 30285868, 30684971, 30975989, 32004580 View all (25 more)
Esophageal Squamous Cell Carcinoma	Stimulate	29866946
Essential Tremor	Associate	36266510
Exanthema	Associate	26952546, 34453221, 36159840
Exfoliation Syndrome	Stimulate	32750756
Extranodal Extension	Stimulate	34511545
Eyelid Neoplasms	Associate	29862664
Familial medullary thyroid carcinoma	Associate	34277966
Familial Primary Pulmonary Hypertension	Stimulate	39769220
Fatigue	Associate	26952546, 27269937, 29545095, 32192573, 33130956, 33849473, 35427471
Feeding and Eating Disorders	Associate	27269937
Fetal Diseases	Associate	37770978
Fever	Stimulate	38350654
Fibrolamellar hepatocellular carcinoma	Associate	30902819
Fibroma Desmoplastic	Associate	38233811
Fibrosarcoma	Associate	30400799, 31331053
Fibrosis	Associate	29093082, 32557663, 32580737, 37121574
Fumaric aciduria	Associate	37131267
Gallbladder Neoplasms	Associate	30055582, 33328484, 35163489, 36826082, 37094985, 37369470, 37841278
Gastritis	Associate	20646001
Gastro enteropancreatic neuroendocrine tumor	Associate	28837143, 30546030, 31128036, 33162477, 33315908
Gastroesophageal Reflux	Associate	26801886
Gastrointestinal Neoplasms	Associate	27777774, 29523759, 32945067, 33180184, 34798858, 35094125, 36996375
Gastrointestinal Stromal Tumors	Associate	25540867, 30714229, 30762585, 32574962, 34276259, 34804639, 40153818
GATA2 Deficiency	Associate	27737703, 30054295, 32766875, 33376237, 33889438, 37148546
Genetic Diseases Inborn	Associate	30401947
Genetic Diseases Inborn	Inhibit	34021249
Germinoma	Associate	29617441, 39958339
Gestational Trophoblastic Disease	Associate	39370035, 39632297
Giant Cell Arteritis	Inhibit	31379838
Giant Cell Tumor of Bone	Associate	32377818, 34285260
Glioblastoma	Associate	20493562, 28178682, 28193626, 28531337, 29532035, 30011045, 30709339, 31467175, 31801317, 32080744, 32201424, 32310827, 32401608, 33282092, 33329573 View all (21 more)
Glioblastoma	Stimulate	23613317
Glioblastoma	Inhibit	30009488
Glioma	Stimulate	23613317
Glioma	Associate	26771840, 27370400, 28475775, 28531337, 28591697, 28620836, 29254497, 29396294, 29396299, 31152305, 31819973, 32424065, 32457124, 33224142, 33282092 View all (18 more)
Gliosarcoma	Associate	34162346, 34876047
Glomerulonephritis	Associate	28770269, 33121190
Glomerulonephritis IGA	Associate	39696012
Glomerulonephritis Membranous	Associate	36701715
Glucagonoma	Associate	26483045
Glucagonoma	Stimulate	37872588
Glucosephosphate Dehydrogenase Deficiency	Associate	27870715, 32474122, 35900726
Glycogen Storage Disease IIIB	Associate	27103510
Glycogen Storage Disease Type IV	Associate	34603331
Graft vs Host Disease	Inhibit	31393854
Graft vs Host Disease	Associate	33598108, 34432868, 36898735
Granuloma	Associate	39373788
Granuloma Foreign Body	Associate	33570446
Graves Disease	Associate	34074094, 35619700
Graves Ophthalmopathy	Associate	35619700
Hand Foot Syndrome	Associate	35586668
Hashimoto Disease	Inhibit	32348468
Hashimoto Disease	Associate	32750756, 34021249, 34074094, 35238073, 36093111, 38457034
Head and Neck Neoplasms	Associate	26676749, 26918453, 27841362, 28476872, 29212506, 29362132, 30219915, 30282672, 30565869, 32699939, 33138288, 35140722, 35834946, 37094985, 38200037, 39939997 View all (1 more)
Head and Neck Neoplasms	Stimulate	34103354
Helicobacter Infections	Associate	35220884
Hemangiosarcoma	Associate	28832074, 30801864, 32294103, 35365586
Hemangiosarcoma	Stimulate	32222780
Hematologic Neoplasms	Associate	32366559, 35081690, 39769169
Hemoglobinuria Paroxysmal	Associate	35173033
Hepatic Encephalopathy	Associate	34938356
Hepatitis B	Associate	21876620, 24842267, 31610173, 34478821, 35746817
Hepatitis B	Stimulate	31367249
Hepatitis B Chronic	Associate	34478821
Hepatitis E	Associate	30510965
Hepatopulmonary Syndrome	Associate	37520536
Hereditary Autoinflammatory Diseases	Associate	35222440
Hereditary Breast and Ovarian Cancer Syndrome	Associate	29057919, 36916425, 37768345
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	32313717
Hereditary leiomyomatosis and renal cell cancer	Associate	27737878, 28893733, 29394125, 29880615, 34980000, 36326378, 37369476
Hereditary leiomyomatosis and renal cell cancer	Stimulate	33720338, 34511545
Hereditary Sensory and Motor Neuropathy	Associate	36884083
Histiocytic Sarcoma	Associate	26110571, 36969238
Histiocytoma Angiomatoid Fibrous	Associate	33500467
Histiocytosis	Associate	26110571
Histiocytosis Langerhans Cell	Stimulate	26110571
Histiocytosis Langerhans Cell	Associate	34713856
HIV Infections	Stimulate	12468426, 23434518, 26633181
HIV Infections	Associate	18317010, 18924219, 19562472, 19726615, 20208540, 23039892, 24626392, 29243049, 30161254, 31394407, 31693657, 34249000, 34597347, 39742336
Hodgkin Disease	Associate	19703193, 22271878, 25482239, 27069084, 27158757, 27737878, 27861596, 28893733, 29394125, 29449276, 29880615, 29902298, 30261066, 30282880, 30564891 View all (24 more)
Hodgkin Disease	Stimulate	30910787
Hutchinson's Melanotic Freckle	Associate	31580843
Hyper IgM Immunodeficiency Syndrome Type 1	Stimulate	30144808
Hypersensitivity Delayed	Associate	23056446, 36911725
Hypersensitivity Delayed	Stimulate	32030476
Hypertension Pregnancy Induced	Associate	29846432
Hypertension Pulmonary	Associate	32703503, 33414372, 36263036
Hypophysitis	Stimulate	31518074
Hypoxia	Stimulate	29693186, 34118979, 34254261, 34367731, 34819027, 35499071, 36445478, 36494419, 37067635, 40429910
Hypoxia	Associate	32255193, 32466213, 32521117, 32802199, 34250747, 34363337, 34484235, 34789838, 35945448, 37240068
Hypoxia Brain	Associate	38418151
Ichthyosis X Linked	Associate	32222780
Idiopathic Pulmonary Fibrosis	Associate	33386384, 37121574
Immune System Diseases	Associate	24376655, 30659749, 33837055, 34597347, 34706885, 37858677
Immunoglobulin G4 Related Disease	Associate	40243629
Immunologic Deficiency Syndromes	Associate	27158757, 36611830
Immunologic Deficiency Syndromes	Stimulate	30429368, 34511545, 35173033
Infarction Middle Cerebral Artery	Associate	40437613
Infections	Associate	21856939, 24187568, 25404022, 28275182, 29093082, 30870532, 32418990
Infections	Stimulate	28056089, 28640134, 32394602, 34511545, 35846769, 36451810
Inflammation	Associate	20515572, 22461641, 22634051, 24015224, 25944800, 26041877, 26867643, 27630241, 27960080, 28223273, 28445951, 28770269, 29416107, 29500362, 29549910 View all (48 more)
Inflammation	Inhibit	20846954, 33754038
Inflammation	Stimulate	21674477, 26260996, 28624577, 30653520, 31001285, 31316519, 35502507, 36945068, 37619986, 37644468, 38161143
Inflammatory Bowel Diseases	Associate	30864556, 35848481
Inflammatory Breast Neoplasms	Stimulate	25940795
Inflammatory Breast Neoplasms	Associate	29425258, 29858752, 30777104, 33267869, 34104544, 34445631, 34542773, 35842661
Influenza Human	Stimulate	24187568, 37172969
Influenza Human	Associate	37239931
Intestinal Diseases	Associate	34497449
Intestinal Neoplasms	Associate	27226337, 28076847, 31152546
Intestinal Perforation	Associate	35427471
Kartagener Syndrome	Associate	15961727
Keratoacanthoma	Associate	29799076
Kidney Diseases	Associate	36275893
Kidney Failure Chronic	Associate	28152514, 35194801
Kidney Neoplasms	Associate	17340590, 30996253, 31672701, 35173532, 35184226, 35240013, 39301023
Klatskin Tumor	Associate	30646854
Krukenberg Tumor	Associate	29854854
Langerhans Cell Sarcoma	Associate	33410565, 34713856
Laryngeal Neoplasms	Associate	23632869, 30361911, 34356594, 37462760
Laryngotracheal Stenosis Progressive with Short Stature and Arthropathy	Associate	32557663
Lead Poisoning Nervous System	Associate	22634051, 33187554, 37068331
Learning Disabilities	Associate	37348508
Left sided gallbladder	Associate	30692096
Leiomyosarcoma	Associate	28440953, 28832074, 32294103, 35349638
Leprosy	Associate	36142557
Leukemia	Associate	16797416, 18756622, 20814675, 23300177, 27708227, 29378725, 31185600, 31705171, 32268011, 35795681, 36960055, 37193972, 37554265
Leukemia Hairy Cell	Associate	35476232
Leukemia Large Granular Lymphocytic	Associate	28548121, 30683910
Leukemia Lymphocytic Chronic B Cell	Associate	22532845, 22547582, 23300177, 26140546, 28075442, 29463802, 30760844, 33173077, 35764886
Leukemia Lymphoma Adult T Cell	Associate	27418641, 27564404, 28496056, 29084771, 35289428, 35417939
Leukemia Monocytic Acute	Associate	18756622
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23383287
Leukemia Myeloid	Associate	23175469
Leukemia Myeloid Acute	Associate	18756622, 20814675, 29449224, 30500073, 31185600, 31291985, 32245463, 33284559, 34171128, 34432868, 35558161, 35794161, 37166484, 37193972, 37431262 View all (5 more)
Leukemia Myelomonocytic Chronic	Stimulate	24270737
Leukemia T Cell	Associate	31775585
Leukemic Infiltration	Associate	37563649
Leukopenia	Associate	35586668
Leukoplakia	Associate	36860910
Leukoplakia Oral	Associate	33861793, 38066025
Leukoplakia Oral	Stimulate	36860910
Lichen Planus	Associate	36825932
Light Fixation Seizure Syndrome	Associate	38290766
Linitis Plastica	Associate	36703611
Liposarcoma	Associate	28832074, 30400799, 32294103, 34237209, 34276259, 35204793, 35349638, 36683495
Liposarcoma Myxoid	Associate	28832074
Liver Cirrhosis	Associate	29093082, 34478821, 36265835
Liver Cirrhosis	Inhibit	39252214
Liver Diseases	Associate	19739236, 34478821, 37308878, 38268921
Liver Failure	Associate	26367730, 35615575
Lown Ganong Levine Syndrome	Associate	28331615, 36921563, 37890351
Lung Diseases	Associate	28387300, 28925087, 32557663, 32591432, 32787374, 33239417, 35398240, 36426899, 37305382
Lung Diseases Interstitial	Associate	32389949, 32648466, 33185333, 33218332, 37535195
Lung Neoplasms	Associate	20514052, 23460533, 25073001, 26014096, 26361045, 26657115, 26667490, 26756646, 26762740, 27393506, 27440266, 27467256, 27502709, 27610620, 27834350 View all (139 more)
Lung Neoplasms	Inhibit	28925087, 31552680
Lung Neoplasms	Stimulate	32468028
Lupus Erythematosus Cutaneous	Associate	35979531
Lupus Erythematosus Discoid	Associate	35979531
Lupus Erythematosus Systemic	Inhibit	18650228
Lupus Erythematosus Systemic	Associate	19759858, 22389764, 24288552, 35979531, 38233074
Lupus Erythematosus Systemic	Stimulate	26867643, 33198645, 33777025
Lupus Nephritis	Stimulate	34081342
Lymphadenopathy	Associate	33608032
Lymphangioleiomyomatosis	Associate	19501877
Lymphatic Metastasis	Associate	24124529, 25733810, 27120796, 27217541, 27591097, 27741514, 28030840, 29291717, 29378617, 29395669, 29516978, 29942303, 30361911, 30539847, 30568128 View all (26 more)
Lymphatic Metastasis	Stimulate	25609202, 28230773, 28522811, 29073638, 30539869, 32389639, 32750756, 33158004, 35845949
Lymphatic Metastasis	Inhibit	28076847
Lymphohistiocytosis Hemophagocytic	Associate	36969238
Lymphoma	Associate	26702065, 26850007, 27527850, 27564404, 27861596, 28496056, 29998979, 30146572, 30683910, 30723112, 30938862, 31150165, 31184237, 32054467, 32248797 View all (5 more)
Lymphoma AIDS Related	Associate	39324141, 40450975
Lymphoma B Cell	Associate	23674495, 26135560, 26599546, 26702065, 27268263, 27419920, 27861596, 28496056, 28756808, 29415979, 30025443, 30209121, 30688388, 30938862, 31150165 View all (11 more)
Lymphoma B Cell Marginal Zone	Associate	34021249
Lymphoma Extranodal NK T Cell	Associate	23674495, 30683910, 31653980
Lymphoma Follicular	Associate	23674495, 35734168
Lymphoma Large B Cell Diffuse	Associate	26239088, 27030389, 27147575, 27527850, 27564404, 27708232, 27861596, 28403071, 28504999, 29246182, 29857068, 29895903, 29946193, 30033844, 30209121 View all (39 more)
Lymphoma Large B Cell Diffuse	Stimulate	32002294
Lymphoma Large Cell Anaplastic	Associate	19703193, 27158757, 28581487, 30093402, 31151983, 31383967
Lymphoma Mantle Cell	Associate	30821551, 31395597, 33745258, 35922773
Lymphoma Non Hodgkin	Associate	19597183, 28187748, 28531337, 29254497, 30025443, 31557757, 32883742, 37629061, 37809067, 38022677, 38173044, 40022698
Lymphoma Primary Effusion	Associate	23674495
Lymphoma T Cell	Associate	19088198, 30025443, 30054295, 31029646, 32424876, 34045609
Lymphoma T Cell Cutaneous	Associate	29895574, 32760603, 35194801, 36990776, 37427589
Lymphoma T Cell Peripheral	Associate	19597183, 30890046, 31074879, 34742294
Lymphomatoid Granulomatosis	Associate	31640798
Lymphopenia	Associate	33317616, 39684323
Lymphoproliferative Disorders	Associate	19597183, 22271878, 23674495, 30033844, 30683910, 31269329, 34842351
Macrophage Activation Syndrome	Associate	39939997
Malignant mesenchymal tumor	Stimulate	26420858
Malignant mesenchymal tumor	Associate	28130401, 28832074, 34655161, 36104728
Mallory Weiss Syndrome	Associate	35535782
Mammary Neoplasms Animal	Associate	36482233
Mastocytosis	Associate	29378725
Mastocytosis Cutaneous	Associate	29378725
Mastocytosis Systemic	Associate	29378725
Medulloblastoma	Associate	34795058
Melanoma	Associate	19651643, 20143437, 20948441, 21346771, 21547596, 22461641, 22850568, 24130734, 24226422, 24639349, 24714771, 24778320, 24812408, 25223485, 25370533 View all (107 more)
Melanoma	Stimulate	29320474, 30880120, 33669410
Melanoma Cutaneous Malignant	Associate	28737763, 29185395, 30236595, 32495158, 32969795, 33262254, 34130989, 35116193, 36466837
Meningioma	Stimulate	25609200
Meningioma	Associate	27624915, 31030234, 32839486, 35289329, 36538194, 39295608
Menkes Kinky Hair Syndrome	Associate	40555045
Mesothelioma	Associate	24926549, 31537897, 36754859, 36901697
Mesothelioma Malignant	Associate	24926549, 25774992, 27544053, 28257959, 28629895, 28811252, 29079455, 29575535, 29946373, 31866087, 32438515, 32929059, 33100328, 33493383, 34261675 View all (8 more)
Metabolic Side Effects of Drugs and Substances	Associate	36800626
Microsatellite Instability	Stimulate	25358689, 25583798, 31092773, 31530839, 33054840, 33229401, 37150803
Microsatellite Instability	Inhibit	26982367
Microsatellite Instability	Associate	27147580, 28405764, 29571084, 30172913, 30377340, 30755167, 31221124, 31270941, 32066859, 32221012, 33732253, 34154614, 34429334, 34761625, 35220884, 36142641, 36996375 View all (2 more)
Monoclonal Gammopathy of Undetermined Significance	Associate	33457074
Mouth Diseases	Stimulate	31142513
Mouth Diseases	Associate	32546692
Mouth Neoplasms	Associate	32041789, 32255193, 34500779, 36231010, 36597662, 37175900, 39595926
Mucopolysaccharidosis III	Associate	36947997
Multiple Myeloma	Associate	17363736, 20460501, 21248470, 21577144, 25979485, 26444869, 26468228, 27418644, 28461396, 31462737, 31991058, 32024967, 32079038, 32724129, 33457074 View all (10 more)
Multiple Sclerosis	Associate	21360758, 30847367, 38422689
Multiple Sclerosis	Stimulate	22067141
Multiple Sulfatase Deficiency Disease	Associate	35427471
Musculoskeletal Diseases	Associate	39334445
Myasthenia Familial Infantile 1	Stimulate	36647116
Mycoses	Associate	36405009
Mycosis Fungoides	Associate	29132694, 35194801, 35373781
Myelodysplastic Syndromes	Associate	20472834, 24270737, 25608238, 31705171, 36810783
Myocarditis	Associate	37827123, 39333574
Myoclonic Epilepsies Progressive	Associate	31697809, 38175373
Myoclonus	Stimulate	34254261
Myoepithelioma	Associate	28832074, 34128136
Myopathies Structural Congenital	Associate	26541760, 35169858, 36263619, 37306737
Myopathy with Lactic Acidosis Hereditary	Stimulate	33558879
Nasal Polyps	Associate	20515572, 36804777
Nasopharyngeal Carcinoma	Associate	23674495, 25361008, 27341634, 27807760, 28256540, 29584545, 31138162, 31664962, 31722750, 32199452, 32564263, 32679194, 33380650, 33402600, 34933967 View all (6 more)
Nasopharyngeal Neoplasms	Associate	32191754
Nausea	Associate	28453692, 34453221
Necrosis	Associate	29789013, 35380716, 36734432
Neoplasm Invasiveness	Associate	25428505, 28363612, 29799076, 31550464, 31586491, 31983188, 35681497, 35773332, 36647116, 37244388, 39356010, 40305358
Neoplasm Invasiveness	Inhibit	30773525
Neoplasm Invasiveness	Stimulate	33158004, 34384268, 35388548
Neoplasm Metastasis	Associate	23179191, 25871477, 26317902, 26464688, 26562534, 26598537, 26761210, 26918453, 27009855, 27045886, 27086918, 27341634, 27729745, 27815126, 27853827 View all (93 more)
Neoplasm Metastasis	Stimulate	23785454, 25669979, 28522811, 30225784, 31489465
Neoplasm Metastasis	Inhibit	30203045, 30980272, 31415379, 32389639, 33239417
Neoplasm Micrometastasis	Associate	26419843
Neoplasm Recurrence Local	Associate	30767115, 36149029
Neoplasm Residual	Associate	39742281
Neoplasms	Associate	15569934, 16208700, 16413538, 16611412, 16797416, 17186290, 17340590, 17360651, 17442937, 18294387, 18355839, 18756622, 19296514, 19380770, 19451266 View all (1975 more)
Neoplasms	Stimulate	19826049, 25669979, 26578623, 27624915, 28629895, 28878242, 28922567, 30475947, 30539869, 30604042, 30761875, 31185600, 31214178, 31250346, 31489465 View all (17 more)
Neoplasms	Inhibit	23632869, 25314913, 30753274, 31332464, 32529292, 32760603, 33421110, 33523584, 34687270, 35493449, 35553632, 38183048, 38327131, 38511744
Neoplasms Germ Cell and Embryonal	Associate	26171934, 27158757, 27638840, 29485980, 39958339
Neoplasms Second Primary	Stimulate	36739599
Neoplasms Squamous Cell	Stimulate	26403783
Neoplasms Squamous Cell	Associate	27683115, 28404915, 30208866, 31429521, 31919132, 32291904, 33227989, 33268574, 33576873, 35984168, 36576530, 36726072, 37305382, 39798194
Neoplasms Unknown Primary	Associate	33732253
Neoplastic Cells Circulating	Associate	28446544
Nerve Sheath Neoplasms	Associate	39321200
Netherton Syndrome	Associate	34377595
Neuhauser syndrome	Associate	33933102
Neuralgia	Associate	26943575
Neurilemmoma	Associate	27158757
Neuroblastoma	Associate	28608950, 33239635, 33655954, 34738358, 35525858, 37130627, 38125723, 39512342
Neuroendocrine Tumors	Associate	28625622, 28923100, 28925087, 29789013, 30400003, 30670493, 31011254, 31557757, 32445029, 33144445, 35671167, 36307579, 36653904, 38125789, 40244846
Neuroendocrine Tumors	Stimulate	34953041
Neurofibrosarcoma	Associate	27588404, 28832074
Neurofibrosarcoma	Stimulate	32193699, 39321200
Neuroma Acoustic	Associate	20601920, 37366935
Neuromyelitis Optica	Stimulate	34394101
Neuroschistosomiasis	Associate	34743724
Neutropenia	Associate	35427471, 37890351
Neutrophil Immunodeficiency Syndrome	Associate	35427471
Neutrophil Immunodeficiency Syndrome	Stimulate	38204755
Nevus Pigmented	Associate	22461641, 25370533
Non alcoholic Fatty Liver Disease	Associate	35615575
Non Muscle Invasive Bladder Neoplasms	Associate	29150702, 32656671, 33335285, 34152439, 34244564, 34819027, 34983384, 35039625, 35041031, 35479097, 35523436, 36043478, 36308190, 36527880, 37283287, 37452272, 38084519, 40603902 View all (3 more)
Non Muscle Invasive Bladder Neoplasms	Inhibit	35227680, 35398827
Nonsyndromic Holoprosencephaly	Associate	39958339
Nose Diseases	Associate	20515572
Obesity	Stimulate	27494857, 34330510
Obesity	Associate	36714595
Oculocutaneous albinism type 2	Associate	36951523
Optic Atrophy Autosomal Dominant	Inhibit	37495171
Oropharyngeal Neoplasms	Associate	32235905, 34903527, 37081578
Osteoarthritis	Associate	39388456
Osteoporosis	Inhibit	34056703
Osteoporotic Fractures	Inhibit	34056703
Osteosarcoma	Associate	24866169, 27456063, 27853827, 28415820, 31981455, 32388585, 33457085, 34196706, 35326493, 36519392, 36739599, 37951196, 37993664
Ovarian Diseases	Associate	28125702, 32334621
Ovarian Neoplasms	Associate	17360651, 24297569, 25081699, 26541760, 26625204, 26871470, 26937756, 27986748, 28187748, 28266500, 28752845, 29027395, 29171986, 29212506, 29351920 View all (55 more)
Ovarian Neoplasms	Stimulate	37221583
Overweight	Associate	31876896, 36714595
Paget Disease Extramammary	Associate	30953116, 31899853
Pain	Associate	30771277, 31393391, 35761436
Pancreatic Intraductal Neoplasms	Associate	37244388
Pancreatic Neoplasms	Associate	20035626, 23029049, 23359812, 25795132, 27589570, 28030840, 29999557, 30426611, 30458888, 31032528, 31043417, 31068935, 31128036, 31284422, 31399545 View all (19 more)
Pancreatitis	Associate	28705256, 30153220, 30185888, 31399545
Papillary Thyroid Microcarcinoma	Associate	34076845
Papilloma	Associate	22322668, 28940446, 35815785, 38193541
Papillomavirus Infections	Associate	26403783, 30980272
Papillomavirus Infections	Stimulate	38186053
Paragangliomas 3	Associate	29775807
Paraparesis Tropical Spastic	Stimulate	23750452
Paraparesis Tropical Spastic	Associate	33767694
Parasitic Diseases	Stimulate	37710023
Pelvic Inflammatory Disease	Associate	30953116, 32730911
Penile Neoplasms	Associate	34449004
Pericardial Effusion	Associate	33181636
Periodontitis	Associate	32041789, 32210958
Peripheral Arterial Disease	Associate	38172197
Peripheral Nervous System Diseases	Associate	34102137
Peritoneal Neoplasms	Associate	27544053, 31407221
Peritonitis	Associate	33580098, 33737722, 37970475
Peritonitis	Stimulate	37768208
Persistent Infection	Associate	35450068
Persistent Mullerian duct syndrome	Associate	30692096
Personality Disorders	Associate	17186290, 29372535, 35240013, 36515567
Personality Disorders	Inhibit	34235004
Pheochromocytoma	Associate	36314599, 37406931
Pituitary Neoplasms	Associate	27655724, 30609812, 33112279, 34745002, 37424874
Placenta Diseases	Associate	38580043
Plaque Atherosclerotic	Associate	34082770, 38172197
Plasmablastic Lymphoma	Associate	32366559
Pleural Diseases	Associate	28980429, 30568128, 39382248
Pleural Diseases	Stimulate	34384268
Pleural Effusion	Associate	28289860, 29246835, 29411536, 30046124, 30856277, 31639551, 38626874
Pleural Effusion Malignant	Associate	29246835, 30642547, 32238865, 32321471, 38626874
Pleurisy	Associate	30655556
Pleuropulmonary blastoma	Associate	34266329
Pneumocephalus	Associate	29895903
Pneumonia	Associate	26952546, 31228626, 35115362, 36773776, 37454214
Polycystic Ovary Syndrome	Associate	33521133
Polycythemia Vera	Associate	31348821, 35015307
Polyendocrinopathies Autoimmune	Associate	33365026
Polypoidal Choroidal Vasculopathy	Associate	35466753, 36804777
Polyposis Syndrome Hereditary Mixed 1	Inhibit	34575971
Polyps	Associate	36804777
Port Wine Stain	Associate	36976297
Pre Eclampsia	Associate	26515425, 28890543, 37905457
Precancerous Conditions	Associate	28438290, 38295311
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	27708227, 37314514
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	30466764, 35610758, 37522711
Primary malignant melanoma of the cervix	Associate	34479920
Primary Myelofibrosis	Associate	34480529, 36266510, 39233645
Prodromal Symptoms	Associate	32107097, 32209338, 34413420, 34864586, 35092391, 35450753, 36016960, 36162037, 36426899, 37454214, 40355865, 40393235
Prostatic Neoplasms	Associate	26260996, 27462860, 27835597, 28223102, 28460462, 29117944, 29212506, 29577933, 30179225, 30385408, 30399174, 30610805, 31035590, 31090214, 31431617 View all (32 more)
Prostatic Neoplasms	Stimulate	30488530
Prostatic Neoplasms Castration Resistant	Associate	29568923, 29577933, 29693186, 31774688, 33849473, 34663638, 35013615, 35491356, 37732622
Prostatic stromal proliferation of uncertain malignant potential	Associate	36579984
Prostatitis	Associate	32916128
Prosthesis Failure	Associate	27484791
Psoriasis	Associate	27185339, 32430334, 35844567, 35848967, 38115636
Pulmonary Arterial Hypertension	Associate	39769220
Pulmonary Disease Chronic Obstructive	Associate	25775429, 26517304, 27252415, 31481045, 32915645, 35860812, 36575294, 37260034
Pulmonary Embolism	Associate	32677947
Pulmonary Emphysema	Associate	25775429
Purpura Thrombocytopenic Idiopathic	Associate	27077771, 29333980, 31651870
Pyruvate Carboxylase Deficiency Disease	Associate	37861993
Radiation Injuries	Associate	28476872
Recombinant chromosome 8 syndrome	Associate	34469533, 36595569
Rectal Neoplasms	Associate	30448924, 30807610, 31261557, 32873251, 32927784, 35502766, 35937503, 36119063, 36238279, 37172969, 37520536, 37838813, 39627663
Recurrent respiratory papillomatosis	Associate	22322668, 28940446, 35815785
Respiratory Distress Syndrome	Associate	29769438, 33452008, 38014923
Respiratory Tract Infections	Associate	18756622, 30062756, 32394602, 32751328, 33130956, 33606065, 33740124, 34050578, 36397276, 37017991, 38320909
Retinal Dysplasia	Associate	32546692, 37686454
Retinal Vein Occlusion	Associate	26367730
Retinoblastoma	Associate	32100078, 33538768
Retroperitoneal liposarcoma	Associate	31385405, 36438917
Rhabdoid Tumor	Associate	30996253
Rhabdomyosarcoma	Associate	27135656, 27393385, 28832074, 30400799, 31704149, 32294103, 34276259, 35371041, 37233406
Rhinitis Allergic	Associate	27617656, 34334005, 37206297
Rhinitis Allergic	Inhibit	31598989
Ribbing disease	Stimulate	30880120
Ring Chromosome 20 Syndrome	Associate	30576970
Rufous oculocutaneous albinism	Stimulate	32750756
Rufous oculocutaneous albinism	Associate	33121520
Salivary Duct Calculi	Associate	30978575, 31237963, 31484986, 31609094, 32350809
Salivary Gland Neoplasms	Associate	29409471, 31484986, 32736208, 35777186, 36169795, 39187586
Sarcoidosis	Associate	25073001, 33570446
Sarcoma	Associate	24349382, 25540867, 25805798, 25906748, 26943575, 27393385, 28463396, 28832074, 29212506, 30400799, 30765880, 30963193, 31617320, 32222780, 32294103 View all (11 more)
Sarcoma Alveolar Soft Part	Associate	25805798, 28832074, 35628499
Sarcoma Clear Cell	Associate	25805798, 39567011
Sarcoma Ewing	Associate	27259563, 27393385, 37993664
Sarcoma Kaposi	Stimulate	29018115
Sarcoma Kaposi	Associate	31394407, 32310306, 36683495
Sarcoma Synovial	Associate	27393385, 28039162, 28832074, 31651363
Sarcoma Synovial	Stimulate	32222780
Schistosomiasis	Associate	34743724
Scleritis	Associate	36118947
Scrub Typhus	Associate	34276693
Sebaceous Gland Neoplasms	Associate	29862664, 31755433, 33398391
Seminoma	Associate	26598537
Seminoma	Stimulate	28423520
Sepsis	Associate	26183035, 33934376, 38014923, 39684323, 40398661
Sepsis	Stimulate	30470767, 35502507
Sezary Syndrome	Associate	35194801, 35373781
Sick Sinus Syndrome	Associate	25795132, 35242133, 37267050
Sick Sinus Syndrome	Stimulate	30992011, 39382248
Sick Sinus Syndrome	Inhibit	31415379
Silicosis	Associate	34022844
Sjogren's Syndrome	Associate	31412888
Sjogren's Syndrome	Stimulate	35020842
Skin Diseases	Associate	26957557, 33239417, 36825932
Sleep Apnea Obstructive	Stimulate	34254261
Sleep Apnea Obstructive	Associate	34768806
Sleep Disorders Circadian Rhythm	Associate	29843813
Sleep Wake Disorders	Associate	36826116
Small Cell Lung Carcinoma	Associate	25384063, 27610620, 27620277, 28152514, 28625622, 29020964, 29049375, 30850021, 31191745, 31659278, 32586767, 33545805, 33584678, 34006632, 34149722 View all (16 more)
Smoke Inhalation Injury	Inhibit	27747247
Smoke Inhalation Injury	Associate	29549910, 30407231, 37452277
smoker's inclusion bodies	Associate	34413168
Smoldering Multiple Myeloma	Associate	33488620
Soft Tissue Injuries	Associate	27213372
Soft Tissue Neoplasms	Associate	32493964
Solitary Fibrous Tumors	Associate	37980418
Solitary Pulmonary Nodule	Associate	32013991
Spinocerebellar Degenerations	Associate	27147580, 30018250, 34254265, 34469533
Spinocerebellar Degenerations	Stimulate	35937946
Splenic Neoplasms	Associate	30633154
Squamous Cell Carcinoma of Head and Neck	Associate	21442435, 23179191, 23288508, 26041877, 26511814, 26562534, 26893364, 26918453, 27329726, 27498988, 27646946, 27717372, 27841362, 27922697, 28122336 View all (132 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	32383556, 35574984
Squamous Cell Carcinoma of Head and Neck	Inhibit	37483588
Squamous Intraepithelial Lesions	Associate	32139873, 40270290
Squamous Intraepithelial Lesions	Stimulate	38295311
Stevens Johnson Syndrome	Associate	35979531
Stomach Diseases	Associate	20646001, 29025424, 36925069, 40275321
Stomach Neoplasms	Associate	12800259, 24242703, 25079317, 25337246, 25733810, 26617827, 26671554, 26801886, 27009855, 27147580, 27191996, 27720576, 27741514, 27889799, 27892511 View all (130 more)
Stomach Neoplasms	Inhibit	32868848, 40105370
Stomach Neoplasms	Stimulate	35879790, 37153541, 37827134
Stomach Ulcer	Associate	29025424
Sunstroke	Associate	28737763
Superinfection	Associate	25428504
Supratentorial Neoplasms	Associate	33387039
Sweat Gland Diseases	Associate	30953116
Sweat Gland Neoplasms	Stimulate	30953116
Syndrome	Associate	30938862
Systemic Vasculitis	Stimulate	34625602
T cell immunodeficiency primary	Associate	26700461
T cell immunodeficiency primary	Stimulate	31821542
Tachycardia Atrioventricular Nodal Reentry	Stimulate	29097495
Tachycardia Atrioventricular Nodal Reentry	Associate	36990776
Tarlov Cysts	Associate	26041877, 30353144, 39356010
Tarlov Cysts	Stimulate	36418844, 37369470, 37563649
Tay Sachs Disease AB Variant	Associate	38539051
Tertiary Lymphoid Structures	Associate	29271413, 30282874, 31367249, 31415379, 36894899, 37660535, 39356010
Tertiary Lymphoid Structures	Stimulate	29374053
Testicular Germ Cell Tumor	Associate	26171934, 26598537, 28423520
Tetrasomy	Associate	31678168
Thrombocytopenia	Associate	35586668
Thrombosis	Associate	30385260, 33549705, 36042047
Thymic epithelial tumor	Associate	25402569, 28281549, 28771603, 29395863, 29850538, 30168897, 34363337
Thymoma	Associate	27158757, 27565906, 27844328, 28281549, 29702286, 29850538, 30600651, 31442209, 34622229, 36683495
Thymoma	Stimulate	30168897
Thymus Neoplasms	Associate	29973653, 32277550, 38071307
Thyroid cancer Hurthle cell	Associate	37529400
Thyroid cancer medullary	Associate	32242507, 34277966, 34580845, 37464189
Thyroid Cancer Papillary	Associate	27086918, 28363612, 28974264, 30832606, 31821747, 32348468, 32750756, 32960462, 34465342, 35238073, 36518249, 37006068, 37905619, 38457034
Thyroid Carcinoma Anaplastic	Associate	25588542, 27045886, 29615459, 31235699, 32364844, 33509020, 34301809, 34397868, 34475850, 35574031, 36202556, 37006068, 37122752, 39586745
Thyroid Carcinoma Anaplastic	Stimulate	36683495
Thyroid Diseases	Associate	29372535
Thyroid Neoplasms	Associate	25701326, 27045886, 29372535, 30832606, 31235699, 31821747, 33247999, 35388548, 35574031, 35818041, 36974635, 36975440, 37006068, 37373171, 37501393, 37506147, 37532555, 39586745 View all (3 more)
Thyroid Neoplasms	Stimulate	33509020
Thyroiditis Autoimmune	Associate	34074094, 34494503, 36518249
Thyroiditis Autoimmune	Inhibit	34074094
Tinea Versicolor	Stimulate	36405009
Tongue Neoplasms	Associate	30588196
Tonsillar Neoplasms	Associate	27776338
Triple Negative Breast Neoplasms	Associate	24764583, 27138582, 27286842, 27912781, 28107186, 28160557, 28230773, 28465490, 28984302, 29063313, 29104508, 29212506, 29291717, 29336717, 29387716 View all (107 more)
Triple Negative Breast Neoplasms	Stimulate	27900363, 33667790, 35268073, 40638667
Triple Negative Breast Neoplasms	Inhibit	34131208
Trophoblastic Neoplasms	Associate	27158757
Tuberculosis	Associate	27924827, 30231065, 33328540, 33570446
Tuberculosis Meningeal	Associate	34597347
Tuberculosis Pulmonary	Associate	23056139, 39386167
Turcot syndrome	Associate	27158757, 27813511, 29053481, 30765880, 31370215, 32060377, 32857459, 33260328, 33603111, 34530255, 35773332, 36581850, 38022513
Uniparental Disomy	Associate	31734631, 35015307
Urethral Neoplasms	Associate	17186290, 25733301, 26952546, 27283319, 28375787, 28552987, 28726535, 28817753, 29103968, 29217288, 29243222, 29271413, 29346180, 29489427, 30062756 View all (49 more)
Urinary Bladder Diseases	Associate	29750666
Urinary Bladder Neoplasms	Associate	17340590, 17686830, 24606459, 25733301, 27269937, 28912897, 29212506, 29271413, 29750666, 29941343, 30315148, 30400941, 30463956, 30666091, 31174611 View all (59 more)
Urogenital Neoplasms	Associate	33262136
Urologic Neoplasms	Associate	32030476, 36397276, 38084519, 38423597, 39739128
Uterine Cervical Diseases	Associate	32322590
Uterine Cervical Dysplasia	Associate	23521696, 26624896, 33552075
Uterine Cervical Dysplasia	Stimulate	26403783
Uterine Cervical Neoplasms	Associate	26403783, 26431490, 27056074, 27721577, 28059093, 28075442, 28112728, 28623908, 29145543, 29212506, 30208866, 31274701, 31348579, 31586491, 31808707 View all (40 more)
Uterine Cervical Neoplasms	Stimulate	33388421
Uterine Cervicitis	Associate	28640134, 29274107, 32322590
Uterine Neoplasms	Associate	24658839, 36104728, 37221583
Uveal Diseases	Inhibit	28737763
Uveal melanoma	Associate	18296654, 28737763, 29185395, 29581543, 31960425, 33136179, 33203661, 33262254, 35341390, 39349498
Vaginal Neoplasms	Associate	33574401
Vasculitis	Associate	34625602
Vasculitis Leukocytoclastic Cutaneous	Stimulate	34625602
Viremia	Associate	12468426, 26633181
Virus Diseases	Associate	21856939, 23288508, 23521696, 38186053
Vitiligo	Associate	32430334
von Hippel Lindau Disease	Inhibit	34407968
Vulvar Neoplasms	Associate	31383965, 35291960, 39798194
Waldenstrom Macroglobulinemia	Associate	30104397, 40349989
Weight Loss	Associate	36099421
Wilms Tumor	Associate	18355839
Wilms Tumor	Stimulate	34519584
Wounds and Injuries	Associate	26183035, 35615575, 38580043
X Linked Combined Immunodeficiency Diseases	Associate	34899684
X Linked Combined Immunodeficiency Diseases	Stimulate	35401534
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	35216384

CD274 (CD274 molecule)