Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29117
Gene name Gene Name - the full gene name approved by the HGNC.	Bromodomain containing 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BRD7
Synonyms (NCBI Gene) Gene synonyms aliases	BP75, CELTIX1, NAG4, SMARCI1
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q12.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein which is a member of the bromodomain-containing protein family. The product of this gene has been identified as a component of one form of the SWI/SNF chromatin remodeling complex, and as a protein which interacts with p53 and

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs796065051	G>A	Likely-pathogenic	Coding sequence variant, non coding transcript variant, stop gained

Show/Hide all(104)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006219	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, Western blot	22015043
MIRT048707	hsa-miR-99a-5p	CLASH	23622248
MIRT037026	hsa-miR-877-3p	CLASH	23622248
MIRT036077	hsa-miR-1296-5p	CLASH	23622248
MIRT527583	hsa-miR-624-3p	PAR-CLIP	20371350
MIRT527582	hsa-miR-4761-3p	PAR-CLIP	20371350
MIRT527581	hsa-miR-300	PAR-CLIP	20371350
MIRT527580	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT527579	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT527578	hsa-miR-4301	PAR-CLIP	20371350
MIRT527577	hsa-miR-6861-5p	PAR-CLIP	20371350
MIRT527576	hsa-miR-503-3p	PAR-CLIP	20371350
MIRT527575	hsa-miR-188-3p	PAR-CLIP	20371350
MIRT527574	hsa-miR-1260a	PAR-CLIP	20371350
MIRT527573	hsa-miR-1260b	PAR-CLIP	20371350
MIRT527572	hsa-miR-3156-3p	PAR-CLIP	20371350
MIRT527583	hsa-miR-624-3p	PAR-CLIP	20371350
MIRT527582	hsa-miR-4761-3p	PAR-CLIP	20371350
MIRT527581	hsa-miR-300	PAR-CLIP	20371350
MIRT527580	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT527579	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT527578	hsa-miR-4301	PAR-CLIP	20371350
MIRT527577	hsa-miR-6861-5p	PAR-CLIP	20371350
MIRT527576	hsa-miR-503-3p	PAR-CLIP	20371350
MIRT527575	hsa-miR-188-3p	PAR-CLIP	20371350
MIRT527574	hsa-miR-1260a	PAR-CLIP	20371350
MIRT527573	hsa-miR-1260b	PAR-CLIP	20371350
MIRT527572	hsa-miR-3156-3p	PAR-CLIP	20371350
MIRT527583	hsa-miR-624-3p	PAR-CLIP	22012620
MIRT527582	hsa-miR-4761-3p	PAR-CLIP	22012620
MIRT527581	hsa-miR-300	PAR-CLIP	22012620
MIRT527580	hsa-miR-381-3p	PAR-CLIP	22012620
MIRT527579	hsa-miR-382-3p	PAR-CLIP	22012620
MIRT527578	hsa-miR-4301	PAR-CLIP	22012620
MIRT527577	hsa-miR-6861-5p	PAR-CLIP	22012620
MIRT527576	hsa-miR-503-3p	PAR-CLIP	22012620
MIRT527575	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT527574	hsa-miR-1260a	PAR-CLIP	22012620
MIRT527573	hsa-miR-1260b	PAR-CLIP	22012620
MIRT527572	hsa-miR-3156-3p	PAR-CLIP	22012620
MIRT441105	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441105	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT527581	hsa-miR-300	Luciferase reporter assay, qRT-PCR, Western blot	26010572
MIRT527583	hsa-miR-624-3p	PAR-CLIP	20371350
MIRT527582	hsa-miR-4761-3p	PAR-CLIP	20371350
MIRT527581	hsa-miR-300	PAR-CLIP	20371350
MIRT527580	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT527579	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT527578	hsa-miR-4301	PAR-CLIP	20371350
MIRT527577	hsa-miR-6861-5p	PAR-CLIP	20371350
MIRT527576	hsa-miR-503-3p	PAR-CLIP	20371350
MIRT527575	hsa-miR-188-3p	PAR-CLIP	20371350
MIRT527574	hsa-miR-1260a	PAR-CLIP	20371350
MIRT527573	hsa-miR-1260b	PAR-CLIP	20371350
MIRT527572	hsa-miR-3156-3p	PAR-CLIP	20371350
MIRT527583	hsa-miR-624-3p	PAR-CLIP	20371350
MIRT527582	hsa-miR-4761-3p	PAR-CLIP	20371350
MIRT527581	hsa-miR-300	PAR-CLIP	20371350
MIRT527580	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT527579	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT527578	hsa-miR-4301	PAR-CLIP	20371350
MIRT527577	hsa-miR-6861-5p	PAR-CLIP	20371350
MIRT527576	hsa-miR-503-3p	PAR-CLIP	20371350
MIRT527575	hsa-miR-188-3p	PAR-CLIP	20371350
MIRT527574	hsa-miR-1260a	PAR-CLIP	20371350
MIRT527573	hsa-miR-1260b	PAR-CLIP	20371350
MIRT527572	hsa-miR-3156-3p	PAR-CLIP	20371350
MIRT527583	hsa-miR-624-3p	PAR-CLIP	22012620
MIRT527582	hsa-miR-4761-3p	PAR-CLIP	22012620
MIRT527581	hsa-miR-300	PAR-CLIP	22012620
MIRT527580	hsa-miR-381-3p	PAR-CLIP	22012620
MIRT527579	hsa-miR-382-3p	PAR-CLIP	22012620
MIRT527578	hsa-miR-4301	PAR-CLIP	22012620
MIRT527577	hsa-miR-6861-5p	PAR-CLIP	22012620
MIRT527576	hsa-miR-503-3p	PAR-CLIP	22012620
MIRT527575	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT527574	hsa-miR-1260a	PAR-CLIP	22012620
MIRT527573	hsa-miR-1260b	PAR-CLIP	22012620
MIRT527572	hsa-miR-3156-3p	PAR-CLIP	22012620
MIRT824517	hsa-miR-1299	CLIP-seq
MIRT824518	hsa-miR-520d-5p	CLIP-seq
MIRT824519	hsa-miR-524-5p	CLIP-seq
MIRT824520	hsa-miR-548ac	CLIP-seq
MIRT824521	hsa-miR-548ae	CLIP-seq
MIRT824522	hsa-miR-548aj	CLIP-seq
MIRT824523	hsa-miR-548am	CLIP-seq
MIRT824524	hsa-miR-548d-3p	CLIP-seq
MIRT824525	hsa-miR-548x	CLIP-seq
MIRT824526	hsa-miR-548z	CLIP-seq
MIRT824527	hsa-miR-561	CLIP-seq
MIRT824528	hsa-miR-639	CLIP-seq
MIRT824529	hsa-miR-875-3p	CLIP-seq
MIRT824517	hsa-miR-1299	CLIP-seq
MIRT1943723	hsa-miR-374c	CLIP-seq
MIRT1943724	hsa-miR-381	CLIP-seq
MIRT1943725	hsa-miR-655	CLIP-seq
MIRT824529	hsa-miR-875-3p	CLIP-seq
MIRT2182455	hsa-miR-1915	CLIP-seq
MIRT1943723	hsa-miR-374c	CLIP-seq
MIRT1943724	hsa-miR-381	CLIP-seq
MIRT2182456	hsa-miR-4267	CLIP-seq
MIRT2182457	hsa-miR-4726-3p	CLIP-seq
MIRT2182458	hsa-miR-556-3p	CLIP-seq
MIRT1943725	hsa-miR-655	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
E2F6	Unknown	16792505
MAX	Unknown	19111069
MYC	Repression	19111069
SP1	Activation	19111069
SP1	Unknown	16792505

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	20228809
GO:0002039	Function	P53 binding	IPI	20228809
GO:0003713	Function	Transcription coactivator activity	IDA	20228809
GO:0003714	Function	Transcription corepressor activity	IDA	16265664
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0005515	Function	Protein binding	IPI	12489984, 18329849, 20228809, 20660729, 29568061, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	11025449, 12489984, 16265664, 20228809
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	TAS	10526152
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	12489984
GO:0007049	Process	Cell cycle	IEA
GO:0008134	Function	Transcription factor binding	IDA	11025449
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20228809
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0035066	Process	Positive regulation of histone acetylation	IDA	20228809
GO:0042393	Function	Histone binding	IDA	12489984
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	16265664
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	20228809
GO:0070577	Function	Lysine-acetylated histone binding	IBA	21873635
GO:0070577	Function	Lysine-acetylated histone binding	IDA	16265664
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IDA	16265664

MIM	HGNC	e!Ensembl
618489	14310	ENSG00000166164

Protein

UniProt ID

Q9NPI1

Protein name

Bromodomain-containing protein 7 (75 kDa bromodomain protein) (Protein CELTIX-1)

Protein function

Acts both as coactivator and as corepressor. May play a role in chromatin remodeling. Activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. Induces dephosphorylation of

PDB

2I7K , 5MQ1 , 6PPA , 6V0Q , 6V16 , 6V17 , 6V1E , 6V1F , 6V1H , 7VDV , 7Y8R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00439	Bromodomain	140 → 223	Bromodomain	Domain
PF12024	DUF3512	298 → 485	Domain of unknown function (DUF3512)	Family

Sequence

MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKD
RKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKP
LTSSLAKQEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFST
MKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSL
KQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKD
MLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPI
VGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFAN
ISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEME
MSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAE
IFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQV
TPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS

Sequence length

651

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling Hepatocellular carcinoma		Regulation of TP53 Activity through Acetylation

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Hypothyroidism	Hypothyroidism	GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease	GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Inhibit	27580131
Alcoholism	Associate	28981154
Anemia Aplastic	Stimulate	29596882
Asthma	Associate	35943053
Breast Neoplasms	Inhibit	25743841
Breast Neoplasms	Associate	30592293, 31929348, 33617509
Carcinogenesis	Associate	25743841
Carcinoma Hepatocellular	Inhibit	26620707
Carcinoma Non Small Cell Lung	Associate	26149213
Colorectal Neoplasms	Associate	12918109
Crohn Disease	Associate	23615072
Hepatitis C	Associate	26620707
Lung Neoplasms	Associate	26802028
Nasopharyngeal Carcinoma	Associate	18071067, 18778484, 27010857
Nasopharyngeal Carcinoma	Inhibit	25743841, 37940358, 39664566
Neoplasm Metastasis	Associate	37940358
Neoplasm Metastasis	Inhibit	39664566
Neoplasms	Associate	12918109, 18778484, 26802028
Neoplasms	Inhibit	20660729, 24840027, 26010572, 26620707, 27010857, 27580131, 28951988, 30592293, 31929348, 37940358, 39664566
Osteoarthritis	Associate	37378023
Osteosarcoma	Inhibit	24840027
Osteosarcoma	Associate	26010572
Prostatic Neoplasms	Associate	34163028, 37478850
Squamous Cell Carcinoma of Head and Neck	Associate	25743841
Stomach Neoplasms	Associate	36477655
Thyroiditis Autoimmune	Associate	37197658
Triple Negative Breast Neoplasms	Associate	23110154

BRD7 (bromodomain containing 7)