Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29110
Gene name Gene Name - the full gene name approved by the HGNC.	TANK binding kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TBK1
Synonyms (NCBI Gene) Gene synonyms aliases	AIARV, FTDALS4, IIAE8, NAK, T2K
Disease Acronyms (UniProt) Disease acronyms from UniProt database	AIARV, FTDALS4, IIAE8
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q14.2
Summary Summary of gene provided in NCBI Entrez Gene.	The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitinat

Show/Hide all(24)

SNP ID	Visualize variation	Clinical significance	Consequence
rs55824172	C>G,T	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs142030898	C>T	Other, pathogenic	Non coding transcript variant, stop gained, coding sequence variant
rs748112833	G>A	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs755950225	A>-	Pathogenic	Non coding transcript variant, frameshift variant, coding sequence variant
rs756751089	A>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs767898276	G>A	Pathogenic	Splice donor variant
rs876657404	TTAA>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs876657405	TG>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs876657406	T>C	Pathogenic	Splice donor variant
rs905184241	C>G	Uncertain-significance, likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1010930015	A>C	Risk-factor	Missense variant, non coding transcript variant, coding sequence variant
rs1027249002	C>A,T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1064797170	C>T	Likely-pathogenic	Non coding transcript variant, stop gained, coding sequence variant
rs1328949478	C>T	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs1341055534	G>A	Pathogenic	Splice donor variant
rs1402092579	AAG>-	Pathogenic	Inframe deletion, coding sequence variant, non coding transcript variant
rs1555202947	G>C	Risk-factor	Missense variant, non coding transcript variant, coding sequence variant
rs1555203557	A>G	Risk-factor	Missense variant, non coding transcript variant, coding sequence variant
rs1555204731	GA>-	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1565814492	->A	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1565825132	G>T	Likely-pathogenic	Stop gained, coding sequence variant, non coding transcript variant
rs1592350883	->A	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1592350887	G>A	Pathogenic	Synonymous variant, coding sequence variant, non coding transcript variant
rs1592362719	G>A	Likely-pathogenic	Splice donor variant

Show/Hide all(227)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006971	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22991189
MIRT006971	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22991189
MIRT003360	hsa-miR-221-3p	Reporter assay;Western blot;Microarray	20018759
MIRT053453	hsa-miR-452-5p	Microarray	23807165
MIRT517392	hsa-miR-3133	PAR-CLIP	20371350
MIRT517391	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT066418	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT066413	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT066415	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT066414	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT517392	hsa-miR-3133	PAR-CLIP	20371350
MIRT517391	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT066418	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT066413	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT066415	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT066414	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT517392	hsa-miR-3133	PAR-CLIP	23446348
MIRT517391	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT066418	hsa-miR-6792-5p	PAR-CLIP	23446348
MIRT066413	hsa-let-7f-2-3p	PAR-CLIP	23446348
MIRT066415	hsa-miR-1185-1-3p	PAR-CLIP	23446348
MIRT066414	hsa-miR-1185-2-3p	PAR-CLIP	23446348
MIRT500838	hsa-miR-219a-2-3p	PAR-CLIP	24398324
MIRT500837	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT006971	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT500835	hsa-miR-429	PAR-CLIP	24398324
MIRT500836	hsa-miR-4724-5p	PAR-CLIP	24398324
MIRT500834	hsa-miR-4680-3p	PAR-CLIP	24398324
MIRT500833	hsa-miR-219b-3p	PAR-CLIP	24398324
MIRT500831	hsa-miR-3671	PAR-CLIP	24398324
MIRT500832	hsa-miR-3674	PAR-CLIP	24398324
MIRT517392	hsa-miR-3133	PAR-CLIP	20371350
MIRT517391	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT066418	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT066413	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT066415	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT066414	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT517392	hsa-miR-3133	PAR-CLIP	20371350
MIRT517391	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT066418	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT066413	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT066415	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT066414	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT517392	hsa-miR-3133	PAR-CLIP	23446348
MIRT517391	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT066418	hsa-miR-6792-5p	PAR-CLIP	23446348
MIRT066413	hsa-let-7f-2-3p	PAR-CLIP	23446348
MIRT066415	hsa-miR-1185-1-3p	PAR-CLIP	23446348
MIRT066414	hsa-miR-1185-2-3p	PAR-CLIP	23446348
MIRT500838	hsa-miR-219a-2-3p	PAR-CLIP	24398324
MIRT500837	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT006971	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT500835	hsa-miR-429	PAR-CLIP	24398324
MIRT500836	hsa-miR-4724-5p	PAR-CLIP	24398324
MIRT500834	hsa-miR-4680-3p	PAR-CLIP	24398324
MIRT500833	hsa-miR-219b-3p	PAR-CLIP	24398324
MIRT500831	hsa-miR-3671	PAR-CLIP	24398324
MIRT500832	hsa-miR-3674	PAR-CLIP	24398324
MIRT755488	hsa-miR-19a-3p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays	35433983
MIRT1414199	hsa-miR-1237	CLIP-seq
MIRT1414200	hsa-miR-1238	CLIP-seq
MIRT1414201	hsa-miR-1248	CLIP-seq
MIRT1414202	hsa-miR-132	CLIP-seq
MIRT1414203	hsa-miR-135a	CLIP-seq
MIRT1414204	hsa-miR-135b	CLIP-seq
MIRT1414205	hsa-miR-142-5p	CLIP-seq
MIRT1414206	hsa-miR-155	CLIP-seq
MIRT1414207	hsa-miR-200b	CLIP-seq
MIRT1414208	hsa-miR-200c	CLIP-seq
MIRT1414209	hsa-miR-212	CLIP-seq
MIRT1414210	hsa-miR-219-2-3p	CLIP-seq
MIRT1414211	hsa-miR-27a	CLIP-seq
MIRT1414212	hsa-miR-27b	CLIP-seq
MIRT1414213	hsa-miR-2964a-3p	CLIP-seq
MIRT1414214	hsa-miR-3119	CLIP-seq
MIRT1414215	hsa-miR-3160-5p	CLIP-seq
MIRT1414216	hsa-miR-3163	CLIP-seq
MIRT1414217	hsa-miR-340	CLIP-seq
MIRT1414218	hsa-miR-362-5p	CLIP-seq
MIRT1414219	hsa-miR-365	CLIP-seq
MIRT1414220	hsa-miR-3910	CLIP-seq
MIRT1414221	hsa-miR-412	CLIP-seq
MIRT1414222	hsa-miR-4252	CLIP-seq
MIRT1414223	hsa-miR-4282	CLIP-seq
MIRT1414224	hsa-miR-4420	CLIP-seq
MIRT1414225	hsa-miR-4466	CLIP-seq
MIRT1414226	hsa-miR-4484	CLIP-seq
MIRT1414227	hsa-miR-4659a-3p	CLIP-seq
MIRT1414228	hsa-miR-4659b-3p	CLIP-seq
MIRT1414229	hsa-miR-4699-3p	CLIP-seq
MIRT1414230	hsa-miR-4729	CLIP-seq
MIRT1414231	hsa-miR-4733-5p	CLIP-seq
MIRT1414232	hsa-miR-500b	CLIP-seq
MIRT1414233	hsa-miR-501-5p	CLIP-seq
MIRT1414234	hsa-miR-513a-3p	CLIP-seq
MIRT1414235	hsa-miR-513a-5p	CLIP-seq
MIRT1414236	hsa-miR-548an	CLIP-seq
MIRT1414237	hsa-miR-577	CLIP-seq
MIRT1414238	hsa-miR-579	CLIP-seq
MIRT1414239	hsa-miR-664	CLIP-seq
MIRT1414240	hsa-miR-675	CLIP-seq
MIRT1414241	hsa-miR-767-3p	CLIP-seq
MIRT1414242	hsa-miR-942	CLIP-seq
MIRT1414243	hsa-miR-944	CLIP-seq
MIRT2124259	hsa-miR-128	CLIP-seq
MIRT2124260	hsa-miR-145	CLIP-seq
MIRT1414207	hsa-miR-200b	CLIP-seq
MIRT1414208	hsa-miR-200c	CLIP-seq
MIRT1414211	hsa-miR-27a	CLIP-seq
MIRT1414212	hsa-miR-27b	CLIP-seq
MIRT2124261	hsa-miR-3125	CLIP-seq
MIRT2124262	hsa-miR-3149	CLIP-seq
MIRT2124263	hsa-miR-3180-5p	CLIP-seq
MIRT2124264	hsa-miR-338-5p	CLIP-seq
MIRT2124265	hsa-miR-3916	CLIP-seq
MIRT2124266	hsa-miR-3919	CLIP-seq
MIRT2124267	hsa-miR-3924	CLIP-seq
MIRT2124268	hsa-miR-3943	CLIP-seq
MIRT2124269	hsa-miR-4286	CLIP-seq
MIRT2124270	hsa-miR-4323	CLIP-seq
MIRT1414229	hsa-miR-4699-3p	CLIP-seq
MIRT2124271	hsa-miR-4712-5p	CLIP-seq
MIRT1414230	hsa-miR-4729	CLIP-seq
MIRT2124272	hsa-miR-4756-3p	CLIP-seq
MIRT2124273	hsa-miR-4758-3p	CLIP-seq
MIRT2124274	hsa-miR-568	CLIP-seq
MIRT1414238	hsa-miR-579	CLIP-seq
MIRT1414239	hsa-miR-664	CLIP-seq
MIRT2124275	hsa-miR-759	CLIP-seq
MIRT1414241	hsa-miR-767-3p	CLIP-seq
MIRT2124276	hsa-miR-770-5p	CLIP-seq
MIRT2124277	hsa-miR-877	CLIP-seq
MIRT2346563	hsa-miR-1279	CLIP-seq
MIRT2124259	hsa-miR-128	CLIP-seq
MIRT1414205	hsa-miR-142-5p	CLIP-seq
MIRT2124260	hsa-miR-145	CLIP-seq
MIRT1414207	hsa-miR-200b	CLIP-seq
MIRT1414208	hsa-miR-200c	CLIP-seq
MIRT1414210	hsa-miR-219-2-3p	CLIP-seq
MIRT1414211	hsa-miR-27a	CLIP-seq
MIRT1414212	hsa-miR-27b	CLIP-seq
MIRT1414213	hsa-miR-2964a-3p	CLIP-seq
MIRT2124261	hsa-miR-3125	CLIP-seq
MIRT2124262	hsa-miR-3149	CLIP-seq
MIRT1414216	hsa-miR-3163	CLIP-seq
MIRT2124263	hsa-miR-3180-5p	CLIP-seq
MIRT2124264	hsa-miR-338-5p	CLIP-seq
MIRT1414217	hsa-miR-340	CLIP-seq
MIRT1414219	hsa-miR-365	CLIP-seq
MIRT2124265	hsa-miR-3916	CLIP-seq
MIRT2124266	hsa-miR-3919	CLIP-seq
MIRT2124268	hsa-miR-3943	CLIP-seq
MIRT1414221	hsa-miR-412	CLIP-seq
MIRT1414223	hsa-miR-4282	CLIP-seq
MIRT2124269	hsa-miR-4286	CLIP-seq
MIRT2124270	hsa-miR-4323	CLIP-seq
MIRT1414224	hsa-miR-4420	CLIP-seq
MIRT1414227	hsa-miR-4659a-3p	CLIP-seq
MIRT1414228	hsa-miR-4659b-3p	CLIP-seq
MIRT1414229	hsa-miR-4699-3p	CLIP-seq
MIRT2124271	hsa-miR-4712-5p	CLIP-seq
MIRT2124272	hsa-miR-4756-3p	CLIP-seq
MIRT2124273	hsa-miR-4758-3p	CLIP-seq
MIRT2346564	hsa-miR-505	CLIP-seq
MIRT1414234	hsa-miR-513a-3p	CLIP-seq
MIRT1414235	hsa-miR-513a-5p	CLIP-seq
MIRT2346565	hsa-miR-520d-5p	CLIP-seq
MIRT2346566	hsa-miR-524-5p	CLIP-seq
MIRT2124274	hsa-miR-568	CLIP-seq
MIRT1414238	hsa-miR-579	CLIP-seq
MIRT1414239	hsa-miR-664	CLIP-seq
MIRT2124275	hsa-miR-759	CLIP-seq
MIRT2124276	hsa-miR-770-5p	CLIP-seq
MIRT2124277	hsa-miR-877	CLIP-seq
MIRT2639251	hsa-miR-1200	CLIP-seq
MIRT1414199	hsa-miR-1237	CLIP-seq
MIRT1414201	hsa-miR-1248	CLIP-seq
MIRT2124259	hsa-miR-128	CLIP-seq
MIRT1414202	hsa-miR-132	CLIP-seq
MIRT1414209	hsa-miR-212	CLIP-seq
MIRT1414211	hsa-miR-27a	CLIP-seq
MIRT1414212	hsa-miR-27b	CLIP-seq
MIRT2639252	hsa-miR-3613-3p	CLIP-seq
MIRT1414218	hsa-miR-362-5p	CLIP-seq
MIRT2639253	hsa-miR-371-5p	CLIP-seq
MIRT2639254	hsa-miR-371b-5p	CLIP-seq
MIRT1414221	hsa-miR-412	CLIP-seq
MIRT1414222	hsa-miR-4252	CLIP-seq
MIRT1414223	hsa-miR-4282	CLIP-seq
MIRT2639255	hsa-miR-4436b-5p	CLIP-seq
MIRT1414225	hsa-miR-4466	CLIP-seq
MIRT1414231	hsa-miR-4733-5p	CLIP-seq
MIRT1414232	hsa-miR-500b	CLIP-seq
MIRT1414233	hsa-miR-501-5p	CLIP-seq
MIRT1414235	hsa-miR-513a-5p	CLIP-seq
MIRT2639256	hsa-miR-513c	CLIP-seq
MIRT2639257	hsa-miR-514b-5p	CLIP-seq
MIRT2346565	hsa-miR-520d-5p	CLIP-seq
MIRT2346566	hsa-miR-524-5p	CLIP-seq
MIRT2639258	hsa-miR-622	CLIP-seq
MIRT2639259	hsa-miR-659	CLIP-seq
MIRT1414240	hsa-miR-675	CLIP-seq
MIRT1414241	hsa-miR-767-3p	CLIP-seq
MIRT2639251	hsa-miR-1200	CLIP-seq
MIRT1414199	hsa-miR-1237	CLIP-seq
MIRT1414201	hsa-miR-1248	CLIP-seq
MIRT2124259	hsa-miR-128	CLIP-seq
MIRT1414202	hsa-miR-132	CLIP-seq
MIRT1414209	hsa-miR-212	CLIP-seq
MIRT1414211	hsa-miR-27a	CLIP-seq
MIRT1414212	hsa-miR-27b	CLIP-seq
MIRT2639252	hsa-miR-3613-3p	CLIP-seq
MIRT1414218	hsa-miR-362-5p	CLIP-seq
MIRT2639253	hsa-miR-371-5p	CLIP-seq
MIRT2639254	hsa-miR-371b-5p	CLIP-seq
MIRT1414221	hsa-miR-412	CLIP-seq
MIRT1414222	hsa-miR-4252	CLIP-seq
MIRT1414223	hsa-miR-4282	CLIP-seq
MIRT1414231	hsa-miR-4733-5p	CLIP-seq
MIRT1414232	hsa-miR-500b	CLIP-seq
MIRT1414233	hsa-miR-501-5p	CLIP-seq
MIRT1414235	hsa-miR-513a-5p	CLIP-seq
MIRT2639256	hsa-miR-513c	CLIP-seq
MIRT2639257	hsa-miR-514b-5p	CLIP-seq
MIRT2346565	hsa-miR-520d-5p	CLIP-seq
MIRT2346566	hsa-miR-524-5p	CLIP-seq
MIRT2639258	hsa-miR-622	CLIP-seq

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002218	Process	Activation of innate immune response	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004672	Function	Protein kinase activity	TAS
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	25636800, 25803835, 27103069
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	21042276
GO:0005515	Function	Protein binding	IPI	14743216, 15841462, 16281057, 16306936, 17568778, 17599067, 18307994, 18583960, 18636086, 18724357, 19153231, 19380580, 19416887, 19419966, 19433799, 20098747, 20174559, 20562859, 20628368, 21813773, 21903422, 21931555, 21988832, 22000020, 22939624, 23096996, 23414517, 23542348, 240
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	21813773, 29251827
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	27103069
GO:0006954	Process	Inflammatory response	TAS	21042276
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS	21042276
GO:0009615	Process	Response to virus	TAS	21042276
GO:0010008	Component	Endosome membrane	TAS
GO:0016032	Process	Viral process	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IDA	27103069
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	25636800, 25803835, 27103069
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	25636800, 27103069
GO:0019903	Function	Protein phosphatase binding	ISS
GO:0032479	Process	Regulation of type I interferon production	IDA	25636800
GO:0032479	Process	Regulation of type I interferon production	TAS
GO:0032480	Process	Negative regulation of type I interferon production	TAS
GO:0032481	Process	Positive regulation of type I interferon production	TAS
GO:0032606	Process	Type I interferon production	TAS	21042276
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	16127453
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	16127453
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	NAS	22412986
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IEA
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	12761501
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0044565	Process	Dendritic cell proliferation	IEA
GO:0045087	Process	Innate immune response	IDA	25636800
GO:0045087	Process	Innate immune response	TAS	21042276
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16127453
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051219	Function	Phosphoprotein binding	IPI	14530355
GO:0051607	Process	Defense response to virus	IEA
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	TAS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1901214	Process	Regulation of neuron death	NAS	25803835
GO:1904417	Process	Positive regulation of xenophagy	IEA

MIM	HGNC	e!Ensembl
604834	11584	ENSG00000183735

Protein

UniProt ID

Q9UHD2

Protein name

Serine/threonine-protein kinase TBK1 (EC 2.7.11.1) (NF-kappa-B-activating kinase) (T2K) (TANK-binding kinase 1)

Protein function

Serine/threonine kinase that plays an essential role in regulating inflammatory responses to foreign agents (PubMed:10581243, PubMed:11839743, PubMed:12692549, PubMed:12702806, PubMed:14703513, PubMed:15367631, PubMed:15485837, PubMed:18583960,

PDB

4EFO , 4EUT , 4EUU , 4IM0 , 4IM2 , 4IM3 , 4IW0 , 4IWO , 4IWP , 4IWQ , 5EOA , 5EOF , 5EP6 , 5W5V , 6BNY , 6BOD , 6BOE , 6CQ0 , 6CQ4 , 6CQ5 , 6NT9 , 6O8B , 6RSR , 6RST , 6RSU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	9 → 299	Protein kinase domain	Domain
PF18396	TBK1_ULD	308 → 395	TANK binding kinase 1 ubiquitin-like domain	Domain
PF18394	TBK1_CCD1	400 → 655	TANK-binding kinase 1 coiled-coil domain 1	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous with higher expression in testis. Expressed in the ganglion cells, nerve fiber layer and microvasculature of the retina. {ECO:0000269|PubMed:10783893, ECO:0000269|PubMed:21447600}.

Sequence

MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLV
LEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITG
VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQE
GTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH
FTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQ
KMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL

Sequence length

729

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Mitophagy - animal Autophagy - animal Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway IL-17 signaling pathway Alcoholic liver disease Amyotrophic lateral sclerosis Pathways of neurodegeneration - multiple diseases Shigellosis Yersinia infection Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Lipid and atherosclerosis		IRF3 mediated activation of type 1 IFN Regulation of innate immune responses to cytosolic DNA STAT6-mediated induction of chemokines IRF3-mediated induction of type I IFN Interleukin-37 signaling TICAM1-dependent activation of IRF3/IRF7 TRAF3-dependent IRF activation pathway TRAF6 mediated IRF7 activation Negative regulators of DDX58/IFIH1 signaling Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis, Amyotrophic lateral sclerosis	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733 View all (171 more)	27260353, 27455348, 29566793, 26581300, 25700176
Apraxia	Apraxias	rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Cerebellar ataxia	Progressive cerebellar ataxia	rs28936415, rs199476133, rs540331226, rs797046006, rs863224069, rs138358708, rs1057519429, rs750959420, rs1568440440, rs1597846084, rs759460806, rs761486324, rs1240335250, rs1596489887
Colorectal cancer	Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)
Frontotemporal dementia	Frontotemporal dementia, Frontotemporal Lobar Degeneration	rs63751273, rs63750376, rs63750424, rs63750972, rs1568327531, rs63750570, rs63750756, rs63751165, rs63750512, rs63751438, rs63750912, rs63750711, rs63750635, rs63750349, rs63750092 View all (31 more)	26581300, 27260353
Frontotemporal dementia with or without amyotrophic lateral sclerosis	FRONTOTEMPORAL DEMENTIA AND/OR AMYOTROPHIC LATERAL SCLEROSIS 4	rs63751126, rs63750355, rs121909334, rs387906789, rs387906790, rs281864934, rs63750652, rs587777574, rs143561967, rs876657404, rs876657405, rs876657406, rs755950225, rs767898276, rs748112833 View all (12 more)	25803835, 25700176, 25943890
Motor neuron disease	Motor Neuron Disease	rs121912431, rs121912439, rs121912437, rs80356719, rs121912441, rs1131690782, rs1131690775, rs895824243, rs1131690781	28089114
Parkinson disease	Parkinsonian Disorders	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Mental depression	Depressive disorder	ClinVar
Ptosis	Blepharoptosis, Ptosis	ClinVar
Frontotemporal Dementia With Motor Neuron Disease	frontotemporal dementia with motor neuron disease	GenCC
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWAS

Show/Hide Text Mining Associations (92)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute On Chronic Liver Failure	Associate	34774066
Adenocarcinoma	Associate	34252349
Adenomyosis	Associate	34010983
Alzheimer Disease	Associate	30549411, 31824497, 39753133
Amyotrophic Lateral Sclerosis	Associate	25700176, 25803835, 25943890, 26365381, 26581300, 26674655, 27156075, 27247382, 28008748, 28822984, 28877469, 29146049, 30033073, 30193106, 31118040 View all (15 more)
Amyotrophic lateral sclerosis 1	Associate	25803835, 30033073, 31748271
Aphasia Primary Progressive	Associate	31160356, 31244341, 32980182, 35964197
Atrophy	Associate	26674655, 31160356, 35964197
Basal Ganglia Diseases	Associate	26674655
Blindness	Associate	31987900
Brain Injuries Traumatic	Associate	36449399
Breast Neoplasms	Associate	24449872
Breast Neoplasms	Stimulate	39185402
Carcinoma Hepatocellular	Stimulate	19958770
Carcinoma Hepatocellular	Associate	25100852, 31730575, 33006365, 37043475
Carcinoma Non Small Cell Lung	Associate	24752990
Carcinoma Pancreatic Ductal	Associate	25833382
Carcinoma Renal Cell	Associate	38211588
CD59 Deficiency	Stimulate	36030554
Cleft Palate	Stimulate	21618603
Cognition Disorders	Associate	40713844
Colitis Ulcerative	Associate	36165492
Colorectal Neoplasms	Associate	24752990, 31869529, 35637944
Corticobasal Degeneration	Associate	31160356
COVID 19	Associate	27094905, 35694544
Coxsackievirus Infections	Associate	36044516
Dementia	Associate	25803835, 26674655, 29859640, 30549411, 31160356, 33061333, 34099552, 37330543
Dermatomyositis	Stimulate	36030554
Developmental Disabilities	Associate	28716898
Diabetes Mellitus Type 2	Associate	28683283
Dysmenorrhea	Associate	34010983
Epidermodysplasia Verruciformis	Associate	36044516
Esophageal Neoplasms	Associate	19558549
Exfoliation Syndrome	Associate	27881886
Fatty Liver	Associate	28683283
Fibrosis	Associate	34774066
Frontotemporal Dementia	Associate	26581300, 26674655, 27156075, 28008748, 29146049, 30193106, 31160356, 31244341, 32413959, 32843152, 32980182, 34099552, 34518945, 34561610, 34800171, 35964197, 40713844 View all (2 more)
Frontotemporal Lobar Degeneration	Associate	25943890, 31160356, 31362587, 32413959
Glaucoma	Associate	21447600, 23421332, 24699864, 27620379, 28282485, 28984711, 31987900, 33548116
Glaucoma Open Angle	Associate	18307994, 21310917, 25284765, 25414181, 27881886
Glioblastoma	Associate	33741083
Hepatic Adenomas Familial	Associate	36769169
Hypoxia	Stimulate	31810986
Hypoxia Brain	Stimulate	16537515
Idiopathic Pulmonary Fibrosis	Associate	32159970
Immune System Diseases	Associate	24860242
Inflammation	Associate	24860242, 28683283, 28716898, 31068249, 32413959, 34099552, 35637944, 35694544, 36449399, 36769169, 36939385, 40341181
Influenza Human	Stimulate	24641803
Insulin Resistance	Associate	28683283
Kidney Neoplasms	Associate	31810986
Leukemia Lymphocytic Chronic B Cell	Associate	36104109
Leukemia Lymphoma Adult T Cell	Associate	32024820
Lewy Body Disease	Associate	31996268
Liver Neoplasms	Associate	27620379, 30033073, 32413959, 36223668, 36769169, 37043475
Low Tension Glaucoma	Associate	21447600, 23286385, 23421332, 24699864, 25284765, 27275741, 27881886, 28984711, 31987900
Lung Neoplasms	Associate	23836654, 24468793, 26656453, 28716898
Lupus Erythematosus Systemic	Associate	36309313
Lymphatic Metastasis	Associate	37991737
Melanoma	Associate	24962318
Memory Disorders	Associate	29146049
Metabolic Diseases	Associate	28683283
Mitochondrial Diseases	Associate	34099552
Motor Neuron Disease	Associate	28089114, 31244341, 37133535
Neoplasms	Associate	16537515, 17018274, 19847166, 24752990, 25028521, 26416897, 27145266, 28716898, 31810986, 33529438, 35637944, 36939385, 38211588
Neoplasms	Inhibit	36988258
Nerve Degeneration	Associate	33548116
Neurodegenerative Diseases	Associate	27247382, 27620379, 29859640, 34800171, 40713844
Neuroinflammatory Diseases	Associate	30193106
Neurotoxicity Syndromes	Associate	31362587
Obesity	Stimulate	28683283
Pancreatic Neoplasms	Associate	24752990, 40315568
Pancreatitis	Associate	36044516
Parkinson Disease	Associate	26365381
Parkinson Disease Familial Type 1	Associate	32980182
Parkinsonian Disorders	Associate	31160356
Periodic fever familial autosomal dominant	Associate	33661274
Primary Progressive Nonfluent Aphasia	Associate	31160356
Pulmonary Disease Chronic Obstructive	Associate	26498252
Pulmonary Fibrosis	Associate	32159970
Sjogren's Syndrome	Associate	40341181
Small Cell Lung Carcinoma	Associate	26772203
Smoke Inhalation Injury	Associate	21618603
Stomach Neoplasms	Associate	27145266
Supranuclear Palsy Progressive	Associate	35842134
TDP 43 Proteinopathies	Associate	31160356, 31244341
Thyroid Neoplasms	Associate	36988258
Triple Negative Breast Neoplasms	Associate	31662325
Tuberculosis Spinal	Associate	39232642
Uterine Diseases	Associate	34010983
Virus Diseases	Associate	34203706, 34908452
von Hippel Lindau Disease	Stimulate	31810986
Zika Virus Infection	Associate	27568284

TBK1 (TANK binding kinase 1)