Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29106
Gene name	Secretogranin III
Gene symbol	SCG3
Synonyms (NCBI Gene)	SGIII
Chromosome	15
Chromosome location	15q21.2
Summary	The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in so

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017386	hsa-miR-335-5p	Microarray	18185580
MIRT1329318	hsa-miR-4466	CLIP-seq
MIRT1329319	hsa-miR-4797-5p	CLIP-seq
MIRT1329320	hsa-miR-509-3p	CLIP-seq
MIRT1329321	hsa-miR-512-3p	CLIP-seq
MIRT1329322	hsa-miR-675	CLIP-seq
MIRT1329323	hsa-miR-759	CLIP-seq
MIRT1329324	hsa-miR-1305	CLIP-seq
MIRT1329325	hsa-miR-2115	CLIP-seq
MIRT1329326	hsa-miR-3119	CLIP-seq
MIRT1329327	hsa-miR-3188	CLIP-seq
MIRT1329328	hsa-miR-330-3p	CLIP-seq
MIRT1329329	hsa-miR-3692	CLIP-seq
MIRT1329318	hsa-miR-4466	CLIP-seq
MIRT1329319	hsa-miR-4797-5p	CLIP-seq
MIRT1329320	hsa-miR-509-3p	CLIP-seq
MIRT1329321	hsa-miR-512-3p	CLIP-seq
MIRT1329330	hsa-miR-539	CLIP-seq
MIRT1329331	hsa-miR-548p	CLIP-seq
MIRT1329332	hsa-miR-580	CLIP-seq
MIRT1329333	hsa-miR-607	CLIP-seq
MIRT1329322	hsa-miR-675	CLIP-seq
MIRT1329323	hsa-miR-759	CLIP-seq
MIRT1329334	hsa-miR-877	CLIP-seq
MIRT1329335	hsa-miR-885-5p	CLIP-seq
MIRT2097663	hsa-miR-1207-3p	CLIP-seq
MIRT2097664	hsa-miR-412	CLIP-seq
MIRT2097665	hsa-miR-4267	CLIP-seq
MIRT2097666	hsa-miR-4691-5p	CLIP-seq
MIRT1329319	hsa-miR-4797-5p	CLIP-seq
MIRT1329320	hsa-miR-509-3p	CLIP-seq
MIRT1329321	hsa-miR-512-3p	CLIP-seq
MIRT2097667	hsa-miR-551a	CLIP-seq
MIRT2097668	hsa-miR-551b	CLIP-seq
MIRT1329323	hsa-miR-759	CLIP-seq
MIRT2618356	hsa-miR-1254	CLIP-seq
MIRT2618357	hsa-miR-1267	CLIP-seq
MIRT2618358	hsa-miR-1291	CLIP-seq
MIRT2618359	hsa-miR-3116	CLIP-seq
MIRT2618360	hsa-miR-3121-5p	CLIP-seq
MIRT2618361	hsa-miR-328	CLIP-seq
MIRT2618362	hsa-miR-661	CLIP-seq
MIRT2618356	hsa-miR-1254	CLIP-seq
MIRT2618357	hsa-miR-1267	CLIP-seq
MIRT2618358	hsa-miR-1291	CLIP-seq
MIRT2618359	hsa-miR-3116	CLIP-seq
MIRT2618360	hsa-miR-3121-5p	CLIP-seq
MIRT2618361	hsa-miR-328	CLIP-seq
MIRT2618362	hsa-miR-661	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
REST	Unknown	19118055

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	19357184, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0016020	Component	Membrane	IEA
GO:0030133	Component	Transport vesicle	IEA
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030667	Component	Secretory granule membrane	IBA
GO:0030667	Component	Secretory granule membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0033366	Process	Protein localization to secretory granule	IBA
GO:0033366	Process	Protein localization to secretory granule	IEA
GO:0034774	Component	Secretory granule lumen	TAS

MIM	HGNC	e!Ensembl
611796	13707	ENSG00000104112

Q8WXD2

Protein name

Secretogranin-3 (Secretogranin III) (SgIII)

Protein function

Member of the granin protein family that regulates the biogenesis of secretory granules (PubMed:19357184). Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA (By similarity). May also play a role in angiogenesis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15467	SGIII	17 → 468	Secretogranin-3	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in urine (at protein level) (PubMed:25326458). Expressed in brain, heart, kidney, liver and skeletal muscle. {ECO:0000269|PubMed:12098761, ECO:0000269|PubMed:25326458}.

Sequence

MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPP
ENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDY
DSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGL
ITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGL
AKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLI
TIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSE
KSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLK
KHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL

Sequence length

468

Interactions

View interactions

	Reactome
			Platelet degranulation Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Post-translational protein phosphorylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Atherosclerosis	Stimulate	14630798	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atresia of small intestine	Associate	21853033	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Inhibit	34257545	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	34257545	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Associate	34360799	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	33952317	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	21796137	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23091610	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	34257545	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	32396724	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	34257545	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	33983957	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Inhibit	32404559	★★★★★ ★☆☆☆☆ Found in Text Mining only

SCG3 (secretogranin III)