Gene Gene information from NCBI Gene database.
Entrez ID 29104
Gene name HemK methyltransferase 2, ETF1 glutamine and histone H4 lysine
Gene symbol HEMK2
Synonyms (NCBI Gene)
C21orf127KMT9MTQ2N6AMTN6AMT1PRED28PrmCm.HsaHemK2P
Chromosome 21
Chromosome location 21q21.3
miRNA miRNA information provided by mirtarbase database.
223
miRTarBase ID miRNA Experiments Reference
MIRT029107 hsa-miR-26b-5p Microarray 19088304
MIRT048642 hsa-miR-99a-5p CLASH 23622248
MIRT496459 hsa-miR-3929 PAR-CLIP 22291592
MIRT496458 hsa-miR-4419b PAR-CLIP 22291592
MIRT496457 hsa-miR-4478 PAR-CLIP 22291592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0005515 Function Protein binding IPI 18539146, 25851604, 31061526, 31632689, 31636962, 34948388
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus ISS
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614553 16021 ENSG00000156239
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y5N5
Protein name Methyltransferase HEMK2 (HemK methyltransferase family member 2) (M.HsaHemK2P) (Lysine N-methyltransferase 9) (EC 2.1.1.-) (Methylarsonite methyltransferase N6AMT1) (EC 2.1.1.-) (Methyltransferase N6AMT1) (Protein N(5)-glutamine methyltransferase) (EC 2.1
Protein function Methyltransferase that can methylate proteins and, to a lower extent, arsenic (PubMed:18539146, PubMed:21193388, PubMed:30017583, PubMed:31061526, PubMed:31636962). Catalytic subunit of a heterodimer with TRMT112, which monomethylates 'Lys-12' o
PDB 6H1D , 6H1E , 6K0X , 6KHS , 6KMR , 6KMS , 6PED , 8CNC , 8QDG , 8QDI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05175 MTS 16 140 Methyltransferase small domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest expression in parathyroid and pituitary glands, followed by adrenal gland and kidney, and lowest expression in leukocytes and mammary gland. {ECO:0000269|PubMed:21193388}.
Sequence
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVS
AFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLV
FNPPYVVTPPQEVGSHGIEA
AWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPE
EILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Sequence length 214
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Methylation
Eukaryotic Translation Termination
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
HYPERPITUITARISM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations