Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29103
Gene name Gene Name - the full gene name approved by the HGNC.
DnaJ heat shock protein family (Hsp40) member C15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAJC15
Synonyms (NCBI Gene) Gene synonyms aliases
DNAJD1, HSD18, MCJ
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q14.11
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT031683 hsa-miR-16-5p Proteomics 18668040
MIRT606986 hsa-miR-6867-5p HITS-CLIP 23313552
MIRT688452 hsa-miR-450b-5p HITS-CLIP 23313552
MIRT688451 hsa-miR-507 HITS-CLIP 23313552
MIRT688450 hsa-miR-557 HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001405 Component PAM complex, Tim23 associated import motor IBA
GO:0001671 Function ATPase activator activity IBA
GO:0005515 Function Protein binding IPI 23263864, 25416956, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615339 20325 ENSG00000120675
Protein
UniProt ID Q9Y5T4
Protein name DnaJ homolog subfamily C member 15 (Cell growth-inhibiting gene 22 protein) (Methylation-controlled J protein) (MCJ)
Protein function Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed at highest levels in heart, followed by liver and kidney. {ECO:0000269|PubMed:11358853, ECO:0000269|PubMed:23530063}.
Sequence
MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRI
WKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVM
ILNHPDKGGSPYVAAKINEAKDLLETTTKH
Sequence length 150
Interactions View interactions
<