Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	291
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 25 member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC25A4
Synonyms (NCBI Gene) Gene synonyms aliases	AAC1, ANT, ANT 1, ANT1, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, T1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q35.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix i

Show/Hide all(14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28999114	A>G	Pathogenic	Missense variant, coding sequence variant
rs104893873	G>C	Pathogenic	Missense variant, coding sequence variant
rs104893874	G>A	Pathogenic	Missense variant, coding sequence variant
rs104893876	T>C	Pathogenic	Missense variant, coding sequence variant
rs121912683	C>A	Pathogenic, uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs398122942	G>A	Pathogenic	Splice donor variant
rs770816416	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs863224208	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs863224209	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs886041080	AGCATGCCAGCAAACAGATCAG>-	Pathogenic	Coding sequence variant, frameshift variant
rs886041081	G>A	Pathogenic	Coding sequence variant, missense variant
rs886041082	C>G	Pathogenic	Coding sequence variant, missense variant
rs1553967481	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1560841701	C>G	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(202)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051905	hsa-let-7b-5p	CLASH	23622248
MIRT043491	hsa-miR-331-3p	CLASH	23622248
MIRT040699	hsa-miR-92b-3p	CLASH	23622248
MIRT615925	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT615924	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615923	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT615922	hsa-miR-7112-3p	HITS-CLIP	23824327
MIRT615921	hsa-miR-4711-5p	HITS-CLIP	23824327
MIRT615920	hsa-miR-4775	HITS-CLIP	23824327
MIRT615919	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615918	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615925	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT615924	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615923	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT615922	hsa-miR-7112-3p	HITS-CLIP	23824327
MIRT615921	hsa-miR-4711-5p	HITS-CLIP	23824327
MIRT615920	hsa-miR-4775	HITS-CLIP	23824327
MIRT615919	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615918	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615925	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT615924	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615923	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT615922	hsa-miR-7112-3p	HITS-CLIP	23824327
MIRT615921	hsa-miR-4711-5p	HITS-CLIP	23824327
MIRT615920	hsa-miR-4775	HITS-CLIP	23824327
MIRT615919	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615918	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615925	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT615924	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615923	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT615922	hsa-miR-7112-3p	HITS-CLIP	23824327
MIRT615921	hsa-miR-4711-5p	HITS-CLIP	23824327
MIRT615920	hsa-miR-4775	HITS-CLIP	23824327
MIRT615919	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615918	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615925	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT615924	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615923	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT615922	hsa-miR-7112-3p	HITS-CLIP	23824327
MIRT615921	hsa-miR-4711-5p	HITS-CLIP	23824327
MIRT615920	hsa-miR-4775	HITS-CLIP	23824327
MIRT615919	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615918	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT615925	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT615924	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615923	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT615922	hsa-miR-7112-3p	HITS-CLIP	23824327
MIRT615921	hsa-miR-4711-5p	HITS-CLIP	23824327
MIRT615920	hsa-miR-4775	HITS-CLIP	23824327
MIRT615919	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT615918	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT1356995	hsa-miR-124	CLIP-seq
MIRT1356996	hsa-miR-181a	CLIP-seq
MIRT1356997	hsa-miR-181b	CLIP-seq
MIRT1356998	hsa-miR-181c	CLIP-seq
MIRT1356999	hsa-miR-181d	CLIP-seq
MIRT1357000	hsa-miR-23a	CLIP-seq
MIRT1357001	hsa-miR-23b	CLIP-seq
MIRT1357002	hsa-miR-23c	CLIP-seq
MIRT1357003	hsa-miR-3136-5p	CLIP-seq
MIRT1357004	hsa-miR-33a	CLIP-seq
MIRT1357005	hsa-miR-33b	CLIP-seq
MIRT1357006	hsa-miR-3545-5p	CLIP-seq
MIRT1357007	hsa-miR-3714	CLIP-seq
MIRT1357008	hsa-miR-3910	CLIP-seq
MIRT1357009	hsa-miR-3929	CLIP-seq
MIRT1357010	hsa-miR-3934	CLIP-seq
MIRT1357011	hsa-miR-4262	CLIP-seq
MIRT1357012	hsa-miR-4419b	CLIP-seq
MIRT1357013	hsa-miR-4439	CLIP-seq
MIRT1357014	hsa-miR-4477b	CLIP-seq
MIRT1357015	hsa-miR-4478	CLIP-seq
MIRT1357016	hsa-miR-4513	CLIP-seq
MIRT1357017	hsa-miR-4648	CLIP-seq
MIRT1357018	hsa-miR-4654	CLIP-seq
MIRT1357019	hsa-miR-4713-5p	CLIP-seq
MIRT1357020	hsa-miR-4760-3p	CLIP-seq
MIRT1357021	hsa-miR-4769-5p	CLIP-seq
MIRT1357022	hsa-miR-489	CLIP-seq
MIRT1357023	hsa-miR-506	CLIP-seq
MIRT1357024	hsa-miR-5095	CLIP-seq
MIRT1357025	hsa-miR-5096	CLIP-seq
MIRT1357026	hsa-miR-552	CLIP-seq
MIRT1357027	hsa-miR-604	CLIP-seq
MIRT1357028	hsa-miR-628-5p	CLIP-seq
MIRT1357029	hsa-miR-647	CLIP-seq
MIRT1357030	hsa-miR-933	CLIP-seq
MIRT1357031	hsa-miR-935	CLIP-seq
MIRT1357032	hsa-miR-944	CLIP-seq
MIRT2105746	hsa-miR-1297	CLIP-seq
MIRT2105747	hsa-miR-26a	CLIP-seq
MIRT2105748	hsa-miR-26b	CLIP-seq
MIRT2105749	hsa-miR-342-5p	CLIP-seq
MIRT2105750	hsa-miR-3615	CLIP-seq
MIRT2105751	hsa-miR-3682-5p	CLIP-seq
MIRT1357010	hsa-miR-3934	CLIP-seq
MIRT2105752	hsa-miR-432	CLIP-seq
MIRT2105753	hsa-miR-4465	CLIP-seq
MIRT2105754	hsa-miR-4502	CLIP-seq
MIRT2105755	hsa-miR-4535	CLIP-seq
MIRT2105756	hsa-miR-4651	CLIP-seq
MIRT2105757	hsa-miR-4664-5p	CLIP-seq
MIRT2105758	hsa-miR-4762-3p	CLIP-seq
MIRT2105759	hsa-miR-4772-3p	CLIP-seq
MIRT2105760	hsa-miR-4776-5p	CLIP-seq
MIRT2105761	hsa-miR-492	CLIP-seq
MIRT1357026	hsa-miR-552	CLIP-seq
MIRT2105762	hsa-miR-608	CLIP-seq
MIRT1357031	hsa-miR-935	CLIP-seq
MIRT1357032	hsa-miR-944	CLIP-seq
MIRT2330208	hsa-let-7a	CLIP-seq
MIRT2330209	hsa-let-7b	CLIP-seq
MIRT2330210	hsa-let-7c	CLIP-seq
MIRT2330211	hsa-let-7d	CLIP-seq
MIRT2330212	hsa-let-7e	CLIP-seq
MIRT2330213	hsa-let-7f	CLIP-seq
MIRT2330214	hsa-let-7g	CLIP-seq
MIRT2330215	hsa-let-7i	CLIP-seq
MIRT2330216	hsa-miR-1200	CLIP-seq
MIRT2330217	hsa-miR-1208	CLIP-seq
MIRT2330218	hsa-miR-1236	CLIP-seq
MIRT1356995	hsa-miR-124	CLIP-seq
MIRT2330219	hsa-miR-1244	CLIP-seq
MIRT2330220	hsa-miR-202	CLIP-seq
MIRT2330221	hsa-miR-204	CLIP-seq
MIRT2330222	hsa-miR-211	CLIP-seq
MIRT2330223	hsa-miR-3170	CLIP-seq
MIRT2330224	hsa-miR-3182	CLIP-seq
MIRT1357004	hsa-miR-33a	CLIP-seq
MIRT1357005	hsa-miR-33b	CLIP-seq
MIRT2330225	hsa-miR-3607-3p	CLIP-seq
MIRT2330226	hsa-miR-3657	CLIP-seq
MIRT2330227	hsa-miR-3672	CLIP-seq
MIRT1357007	hsa-miR-3714	CLIP-seq
MIRT1357008	hsa-miR-3910	CLIP-seq
MIRT2330228	hsa-miR-3935	CLIP-seq
MIRT2330229	hsa-miR-4259	CLIP-seq
MIRT2330230	hsa-miR-4289	CLIP-seq
MIRT2330231	hsa-miR-4303	CLIP-seq
MIRT2330232	hsa-miR-4324	CLIP-seq
MIRT2330233	hsa-miR-4325	CLIP-seq
MIRT2330234	hsa-miR-4420	CLIP-seq
MIRT2330235	hsa-miR-4425	CLIP-seq
MIRT2330236	hsa-miR-4446-5p	CLIP-seq
MIRT2330237	hsa-miR-4458	CLIP-seq
MIRT1357014	hsa-miR-4477b	CLIP-seq
MIRT2330238	hsa-miR-4500	CLIP-seq
MIRT2105754	hsa-miR-4502	CLIP-seq
MIRT2330239	hsa-miR-450b-3p	CLIP-seq
MIRT2330240	hsa-miR-4639-3p	CLIP-seq
MIRT2330241	hsa-miR-4649-3p	CLIP-seq
MIRT2330242	hsa-miR-4669	CLIP-seq
MIRT2330243	hsa-miR-4677-3p	CLIP-seq
MIRT2330244	hsa-miR-4678	CLIP-seq
MIRT2330245	hsa-miR-4679	CLIP-seq
MIRT2330246	hsa-miR-4698	CLIP-seq
MIRT2330247	hsa-miR-4703-3p	CLIP-seq
MIRT2330248	hsa-miR-4715-5p	CLIP-seq
MIRT2330249	hsa-miR-4755-5p	CLIP-seq
MIRT1357023	hsa-miR-506	CLIP-seq
MIRT1357024	hsa-miR-5095	CLIP-seq
MIRT2330250	hsa-miR-544b	CLIP-seq
MIRT2330251	hsa-miR-581	CLIP-seq
MIRT2330252	hsa-miR-592	CLIP-seq
MIRT2330253	hsa-miR-599	CLIP-seq
MIRT2330254	hsa-miR-623	CLIP-seq
MIRT2330255	hsa-miR-720	CLIP-seq
MIRT2330256	hsa-miR-769-3p	CLIP-seq
MIRT1357031	hsa-miR-935	CLIP-seq
MIRT2330257	hsa-miR-98	CLIP-seq
MIRT2394681	hsa-miR-2467-3p	CLIP-seq
MIRT2394682	hsa-miR-3123	CLIP-seq
MIRT2394683	hsa-miR-3668	CLIP-seq
MIRT2394684	hsa-miR-3678-3p	CLIP-seq
MIRT2394685	hsa-miR-3919	CLIP-seq
MIRT2330228	hsa-miR-3935	CLIP-seq
MIRT2105752	hsa-miR-432	CLIP-seq
MIRT2105755	hsa-miR-4535	CLIP-seq
MIRT2394686	hsa-miR-4717-3p	CLIP-seq
MIRT2105760	hsa-miR-4776-5p	CLIP-seq
MIRT2105761	hsa-miR-492	CLIP-seq
MIRT2394687	hsa-miR-577	CLIP-seq
MIRT2394688	hsa-miR-597	CLIP-seq
MIRT1357031	hsa-miR-935	CLIP-seq
MIRT1357031	hsa-miR-935	CLIP-seq
MIRT2330217	hsa-miR-1208	CLIP-seq
MIRT2330225	hsa-miR-3607-3p	CLIP-seq
MIRT2330234	hsa-miR-4420	CLIP-seq
MIRT2330243	hsa-miR-4677-3p	CLIP-seq
MIRT2330245	hsa-miR-4679	CLIP-seq
MIRT2624277	hsa-miR-129-5p	CLIP-seq
MIRT2105746	hsa-miR-1297	CLIP-seq
MIRT2105747	hsa-miR-26a	CLIP-seq
MIRT2105748	hsa-miR-26b	CLIP-seq
MIRT2624278	hsa-miR-3149	CLIP-seq
MIRT2105750	hsa-miR-3615	CLIP-seq
MIRT1357010	hsa-miR-3934	CLIP-seq
MIRT2105753	hsa-miR-4465	CLIP-seq
MIRT2624279	hsa-miR-4735-5p	CLIP-seq
MIRT1357024	hsa-miR-5095	CLIP-seq
MIRT1357026	hsa-miR-552	CLIP-seq
MIRT1357030	hsa-miR-933	CLIP-seq

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005471	Function	ATP:ADP antiporter activity	IDA	21586654
GO:0005471	Function	ATP:ADP antiporter activity	IEA
GO:0005515	Function	Protein binding	IPI	16507998, 21370995, 24316735, 24725412, 31883789, 33961781
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	10926541
GO:0005743	Component	Mitochondrial inner membrane	IDA	21586654
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005757	Component	Mitochondrial permeability transition pore complex	IEA
GO:0005757	Component	Mitochondrial permeability transition pore complex	ISS
GO:0005886	Component	Plasma membrane	TAS	2823266
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	2823266
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0015078	Function	Proton transmembrane transporter activity	IEA
GO:0015078	Function	Proton transmembrane transporter activity	TAS
GO:0015207	Function	Adenine transmembrane transporter activity	TAS	2823266
GO:0015297	Function	Antiporter activity	IEA
GO:0015853	Process	Adenine transport	IEA
GO:0015866	Process	ADP transport	IMP	27693233
GO:0016020	Component	Membrane	IDA	27641616
GO:0016020	Component	Membrane	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	ISS
GO:0031966	Component	Mitochondrial membrane	ISS
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0060546	Process	Negative regulation of necroptotic process	IMP	16507998
GO:0140021	Process	Mitochondrial ADP transmembrane transport	IDA	21586654
GO:0140021	Process	Mitochondrial ADP transmembrane transport	IEA
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IBA
GO:1901526	Process	Positive regulation of mitophagy	IEA
GO:1901526	Process	Positive regulation of mitophagy	ISS
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990544	Process	Mitochondrial ATP transmembrane transport	IDA	21586654
GO:1990544	Process	Mitochondrial ATP transmembrane transport	IEA
GO:1990845	Process	Adaptive thermogenesis	IEA
GO:1990845	Process	Adaptive thermogenesis	ISS
GO:1990845	Process	Adaptive thermogenesis	TAS

MIM	HGNC	e!Ensembl
103220	10990	ENSG00000151729

Protein

UniProt ID

P12235

Protein name

ADP/ATP translocase 1 (ADP,ATP carrier protein 1) (ADP,ATP carrier protein, heart/skeletal muscle isoform T1) (Adenine nucleotide translocator 1) (ANT 1) (Solute carrier family 25 member 4)

Protein function

ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (PubMed:21586654, PubMed:27693233). Cycles between the cytoplasmic-open state (c-state) and the matrix-open st

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	4 → 103	Mitochondrial carrier protein	Family
PF00153	Mito_carr	109 → 206	Mitochondrial carrier protein	Family
PF00153	Mito_carr	204 → 298	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in erythrocytes (at protein level). {ECO:0000269|PubMed:27641616}.

Sequence

MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Sequence length

298

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cGMP-PKG signaling pathway Necroptosis Cellular senescence Neutrophil extracellular trap formation Alzheimer disease Parkinson disease Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases Influenza A Human T-cell leukemia virus 1 infection Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Mitochondrial protein import Vpr-mediated induction of apoptosis by mitochondrial outer membrane permeabilization Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Cardiomyopathic Mitochondrial DNA Depletion Syndrome	mitochondrial dna depletion syndrome 12a (cardiomyopathic type), autosomal dominant, mitochondrial dna depletion syndrome 12b (cardiomyopathic type), autosomal recessive	rs886041082, rs886041080, rs770816416, rs1560841701, rs121912683, rs398122942, rs863224209, rs886041081	N/A
progressive external ophthalmoplegia with mitochondrial dna deletions	Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal dominant 2	rs104893873, rs104893874, rs104893876, rs28999114, rs863224209	N/A
Fatal Mitochondrial Disease	Mitochondrial disease	rs886041081, rs886041082	N/A

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer specific mortality in estrogen receptor positive breast cancer	N/A	N/A	GWAS
Leigh Syndrome	Leigh syndrome	N/A	N/A	GenCC
Restrictive cardiomyopathy	restrictive cardiomyopathy	N/A	N/A	ClinVar
Sengers syndrome	Sengers syndrome	N/A	N/A	GenCC

Show/Hide Text Mining Associations (40)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arrhythmias Cardiac	Associate	36030628
Atherosclerosis	Associate	40053030
Atrophy	Associate	35477912
Carcinoma Renal Cell	Associate	32461965
Cardiomyopathies	Associate	18809618, 23401503, 27693233, 30165862
Cardiomyopathy Dilated	Associate	16107323
Cognition Disorders	Associate	28690391
Colonic Neoplasms	Inhibit	36254139
Congenital Abnormalities	Associate	19687137
Death	Associate	19687137
Dementia	Associate	28690391
Diabetes Mellitus Type 2	Associate	36360309
Fatigue	Associate	23047795
Glioblastoma	Associate	20528917
Hemorrhage	Associate	40053030
Hydranencephaly	Associate	35477912
Insulin Resistance	Associate	24884163
Kearns Sayre Syndrome	Associate	35477912
Kearns Sayre Syndrome	Inhibit	8505336
Kidney Neoplasms	Associate	33396658
MELAS Syndrome	Associate	8505336
MERRF Syndrome	Stimulate	8505336
Mitochondrial Diseases	Associate	18809618, 20528917, 27693233, 33923309
Mitochondrial Myopathies	Associate	18809618, 27693233
Muscular Diseases	Associate	23401503
Muscular Dystrophy Facioscapulohumeral	Associate	18852887, 19809486, 19888305, 36030628
Myopathy with Giant Abnormal Mitochondria	Associate	27861892, 28317877, 36030628
Neurodegenerative Diseases	Associate	33923309
Ophthalmoplegia Chronic Progressive External	Associate	18195150, 19687137, 21301859, 37316776
Parkinson Disease Secondary	Associate	21301859
Pontocerebellar Hypoplasia Type 3	Associate	35477912
Progressive External Ophthalmoplegia with Mitochondrial DNA Deletions Autosomal Dominant 1	Associate	18809618, 19772189, 27693233, 28690391
Prostatic Neoplasms	Associate	23047795
Sleep Deprivation	Associate	36030628
Stomach Diseases	Associate	36356476
Stomach Neoplasms	Associate	31322220
Stomach Neoplasms	Inhibit	36254139
Stomach Neoplasms	Stimulate	36356476
Ventricular Dysfunction	Associate	37957180
Visceral myopathy familial external ophthalmoplegia	Associate	19667227, 39277702

SLC25A4 (solute carrier family 25 member 4)