Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	29086
Gene name	BRISC and BRCA1 A complex member 1
Gene symbol	BABAM1
Synonyms (NCBI Gene)	C19orf62HSPC142MERIT40NBA1
Chromosome	19
Chromosome location	19p13.11

Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022677	hsa-miR-124-3p	Microarray	18668037
MIRT029479	hsa-miR-26b-5p	Microarray	19088304
MIRT048297	hsa-miR-107	CLASH	23622248
MIRT814131	hsa-miR-377	CLIP-seq
MIRT814132	hsa-miR-4470	CLIP-seq
MIRT814133	hsa-miR-548c-3p	CLIP-seq
MIRT1940723	hsa-miR-3130-5p	CLIP-seq
MIRT1940724	hsa-miR-4482	CLIP-seq
MIRT1940725	hsa-miR-580	CLIP-seq
MIRT2179719	hsa-miR-1295	CLIP-seq
MIRT2179720	hsa-miR-146a	CLIP-seq
MIRT2179721	hsa-miR-146b-5p	CLIP-seq
MIRT1940723	hsa-miR-3130-5p	CLIP-seq
MIRT2179722	hsa-miR-3690	CLIP-seq
MIRT2179723	hsa-miR-4254	CLIP-seq
MIRT1940724	hsa-miR-4482	CLIP-seq
MIRT2179724	hsa-miR-4717-5p	CLIP-seq
MIRT1940725	hsa-miR-580	CLIP-seq
MIRT2179725	hsa-miR-589	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 19261748, 19261749, 19615732, 21044950, 22153077, 25416956, 28514442, 31515488, 32296183, 33961781, 37398436
GO:0005634	Component	Nucleus	IDA	19261746, 19261748, 19261749
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20656689
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	19261749, 24075985
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	NAS	20656689
GO:0006302	Process	Double-strand break repair	IBA
GO:0006302	Process	Double-strand break repair	IMP	19261746, 19261748, 19261749
GO:0006325	Process	Chromatin organization	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IBA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IMP	19261746, 19261748, 19261749
GO:0010212	Process	Response to ionizing radiation	IMP	19261748, 19261749
GO:0016604	Component	Nuclear body	IBA
GO:0016604	Component	Nuclear body	IDA
GO:0042802	Function	Identical protein binding	IPI	37398436
GO:0044818	Process	Mitotic G2/M transition checkpoint	NAS	22369660
GO:0045739	Process	Positive regulation of DNA repair	IEA
GO:0045739	Process	Positive regulation of DNA repair	IMP	19261746, 19261748, 19261749
GO:0051301	Process	Cell division	IEA
GO:0070531	Component	BRCA1-A complex	IBA
GO:0070531	Component	BRCA1-A complex	IDA	19261746, 19261748, 19261749
GO:0070531	Component	BRCA1-A complex	IEA
GO:0070531	Component	BRCA1-A complex	NAS	20656689
GO:0070552	Component	BRISC complex	IBA
GO:0070552	Component	BRISC complex	IDA	19214193, 24075985
GO:0070552	Component	BRISC complex	IEA
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IMP	19261746

MIM	HGNC	e!Ensembl
612766	25008	ENSG00000105393

Q9NWV8

Protein name

BRISC and BRCA1-A complex member 1 (Mediator of RAP80 interactions and targeting subunit of 40 kDa) (New component of the BRCA1-A complex)

Protein function

Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs

PDB

6H3C , 8PVY , 8PY2

Family and domains

Sequence

MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADD
GSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNA
LNVSQKMIEMFVRTKHKIDKSHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCST
FNLEGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMKKMFQCPY
FFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKYEVALAGPALELHNCMAKLLA
HPLQRPCQSHASYSLLEEEDEAIEVEATV

Sequence length

329

Interactions

View interactions

	KEGG		Reactome
	Homologous recombination		Metalloprotease DUBs Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Nonhomologous End-Joining (NHEJ) Processing of DNA double-strand break ends G2/M DNA damage checkpoint

BABAM1 (BRISC and BRCA1 A complex member 1)