Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29086
Gene name Gene Name - the full gene name approved by the HGNC.
BRISC and BRCA1 A complex member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BABAM1
Synonyms (NCBI Gene) Gene synonyms aliases
C19orf62, HSPC142, MERIT40, NBA1
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022677 hsa-miR-124-3p Microarray 18668037
MIRT029479 hsa-miR-26b-5p Microarray 19088304
MIRT048297 hsa-miR-107 CLASH 23622248
MIRT814131 hsa-miR-377 CLIP-seq
MIRT814132 hsa-miR-4470 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 19261748, 19261749, 19615732, 21044950, 22153077, 25416956, 28514442, 31515488, 32296183, 33961781, 37398436
GO:0005634 Component Nucleus IDA 19261746, 19261748, 19261749
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus NAS 20656689
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612766 25008 ENSG00000105393
Protein
UniProt ID Q9NWV8
Protein name BRISC and BRCA1-A complex member 1 (Mediator of RAP80 interactions and targeting subunit of 40 kDa) (New component of the BRCA1-A complex)
Protein function Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs
PDB 6H3C , 8PVY , 8PY2
Family and domains
Sequence
MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADD
GSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNA
LNVSQKMIEMFVRTKHKIDKSHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCST
FNLEGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMKKMFQCPY
FFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKYEVALAGPALELHNCMAKLLA
HPLQRPCQSHASYSLLEEEDEAIEVEATV
Sequence length 329
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Homologous recombination   Metalloprotease DUBs
Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
Nonhomologous End-Joining (NHEJ)
Processing of DNA double-strand break ends
G2/M DNA damage checkpoint
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast cancer Breast Cancer in BRCA1 mutation carriers, Breast cancer (estrogen-receptor negative), Breast cancer N/A N/A GWAS
Ovarian cancer Epithelial ovarian cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 19572197, 20852631, 21799032, 21844186, 22331459, 22351618, 23136140, 23593120, 24528085, 26027929, 26472073
Breast Neoplasms Stimulate 37248434
Carcinoma Ovarian Epithelial Associate 20852633, 26747452
Carcinoma Squamous Cell Associate 28115406
Diabetes Gestational Associate 37664858
DNA Virus Infections Associate 26027929
Hereditary Breast and Ovarian Cancer Syndrome Associate 22351618, 28115406
Macular Edema Associate 37585454
Neoplasms Associate 26848770
Neoplasms Inhibit 26848770