Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2908
Gene name	Nuclear receptor subfamily 3 group C member 1
Gene symbol	NR3C1
Synonyms (NCBI Gene)	GCCRGCRGCRSTGRGRL
Chromosome	5
Chromosome location	5q31.3
Summary	This gene encodes glucocorticoid receptor, which can function both as a transcription factor that binds to glucocorticoid response elements in the promoters of glucocorticoid responsive genes to activate their transcription, and as a regulator of other tr

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6189	C>A,T	Benign-likely-benign, pathogenic	Genic upstream transcript variant, 5 prime UTR variant, upstream transcript variant, missense variant, coding sequence variant, intron variant, synonymous variant
rs104893908	T>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs104893909	A>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs104893910	A>C,G	Pathogenic	Missense variant, intron variant, coding sequence variant, non coding transcript variant, synonymous variant, genic downstream transcript variant
rs104893911	A>G	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs104893912	A>G	Pathogenic	Missense variant, intron variant, coding sequence variant, non coding transcript variant, genic downstream transcript variant
rs104893913	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs104893914	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant, genic downstream transcript variant
rs121909726	T>A	Pathogenic	Intron variant, coding sequence variant, missense variant, non coding transcript variant, genic downstream transcript variant
rs121909727	A>G	Pathogenic	Intron variant, coding sequence variant, missense variant, non coding transcript variant, genic downstream transcript variant
rs587776832	CTCA>-	Pathogenic	Non coding transcript variant, coding sequence variant, splice donor variant

661

Show/Hide all (661)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004545	hsa-miR-18a-5p	Luciferase reporter assay	19131573
MIRT004546	hsa-miR-124-3p	Luciferase reporter assay	19131573
MIRT004545	hsa-miR-18a-5p	Western blot	19131573
MIRT004546	hsa-miR-124-3p	Western blot	19131573
MIRT004545	hsa-miR-18a-5p	pMIR-REPORT	19131573
MIRT004546	hsa-miR-124-3p	pMIR-REPORT	19131573
MIRT004546	hsa-miR-124-3p	pMIR-REPORT	19131573
MIRT004546	hsa-miR-124-3p	pMIR-REPORT	19131573
MIRT004546	hsa-miR-124-3p	Luciferase reporter assayNorthern blotWestern blot	19131573
MIRT016193	hsa-miR-590-3p	Sequencing	20371350
MIRT020164	hsa-miR-130b-3p	Sequencing	20371350
MIRT020725	hsa-miR-155-5p	Proteomics	18668040
MIRT004546	hsa-miR-124-3p	Microarray	18668037
MIRT028300	hsa-miR-32-5p	Sequencing	20371350
MIRT030650	hsa-miR-22-3p	Sequencing	20371350
MIRT031124	hsa-miR-19b-3p	Sequencing	20371350
MIRT039437	hsa-miR-421	CLASH	23622248
MIRT687449	hsa-miR-138-5p	HITS-CLIP	23313552
MIRT687448	hsa-miR-137	HITS-CLIP	23313552
MIRT095604	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT687447	hsa-miR-6800-3p	HITS-CLIP	23313552
MIRT214865	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT095600	hsa-miR-4699-3p	HITS-CLIP	23313552
MIRT687446	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT095597	hsa-miR-1279	HITS-CLIP	23313552
MIRT687445	hsa-miR-3130-3p	HITS-CLIP	23313552
MIRT687444	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT687443	hsa-miR-3182	HITS-CLIP	23313552
MIRT687442	hsa-miR-3928-5p	HITS-CLIP	23313552
MIRT687441	hsa-miR-6806-3p	HITS-CLIP	23313552
MIRT687440	hsa-miR-5186	HITS-CLIP	23313552
MIRT687439	hsa-miR-133a-5p	HITS-CLIP	23313552
MIRT687438	hsa-miR-6131	HITS-CLIP	23313552
MIRT687437	hsa-miR-196a-3p	HITS-CLIP	23313552
MIRT687436	hsa-miR-496	HITS-CLIP	23313552
MIRT687435	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT687434	hsa-miR-127-5p	HITS-CLIP	23313552
MIRT391240	hsa-miR-192-3p	HITS-CLIP	23313552
MIRT687433	hsa-miR-1263	HITS-CLIP	23313552
MIRT687432	hsa-miR-544a	HITS-CLIP	23313552
MIRT687431	hsa-miR-4652-3p	HITS-CLIP	23313552
MIRT687430	hsa-miR-182-5p	HITS-CLIP	23313552
MIRT687429	hsa-miR-6868-3p	HITS-CLIP	23313552
MIRT566613	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT440092	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT566612	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT312331	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT566611	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT566610	hsa-miR-1179	PAR-CLIP	20371350
MIRT214857	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT566609	hsa-miR-5692b	PAR-CLIP	20371350
MIRT566608	hsa-miR-5692c	PAR-CLIP	20371350
MIRT329361	hsa-miR-4528	PAR-CLIP	20371350
MIRT095611	hsa-miR-4672	PAR-CLIP	20371350
MIRT566607	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT095612	hsa-miR-5590-5p	PAR-CLIP	20371350
MIRT566606	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT566605	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT566604	hsa-miR-2355-3p	PAR-CLIP	20371350
MIRT378074	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT214899	hsa-miR-618	PAR-CLIP	21572407
MIRT555970	hsa-miR-6757-5p	PAR-CLIP	21572407
MIRT555969	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT555968	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT555967	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT555966	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT555964	hsa-miR-3162-5p	PAR-CLIP	21572407
MIRT471981	hsa-miR-4282	PAR-CLIP	23592263
MIRT471980	hsa-miR-8485	PAR-CLIP	23592263
MIRT471979	hsa-miR-329-3p	PAR-CLIP	23592263
MIRT471978	hsa-miR-362-3p	PAR-CLIP	23592263
MIRT471977	hsa-miR-603	PAR-CLIP	23592263
MIRT471976	hsa-miR-5582-5p	PAR-CLIP	23592263
MIRT471975	hsa-miR-3622a-5p	PAR-CLIP	23592263
MIRT471974	hsa-miR-5586-5p	PAR-CLIP	23592263
MIRT471973	hsa-miR-6849-3p	PAR-CLIP	23592263
MIRT471972	hsa-miR-125b-1-3p	PAR-CLIP	23592263
MIRT471971	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT095609	hsa-miR-3941	PAR-CLIP	23592263
MIRT095608	hsa-miR-466	PAR-CLIP	23592263
MIRT471970	hsa-miR-4423-3p	PAR-CLIP	23592263
MIRT471969	hsa-miR-6512-3p	PAR-CLIP	23592263
MIRT471968	hsa-miR-6720-5p	PAR-CLIP	23592263
MIRT440092	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT440091	hsa-miR-377-3p	HITS-CLIP	24374217
MIRT440092	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT440091	hsa-miR-377-3p	HITS-CLIP	24374217
MIRT020164	hsa-miR-130b-3p	qRT-PCRWestern blot	26475357
MIRT004545	hsa-miR-18a-5p	Luciferase reporter assayWestern blot	27888798
MIRT004545	hsa-miR-18a-5p	Luciferase reporter assayWestern blot	27888798
MIRT566612	hsa-miR-144-3p	Luciferase reporter assayqRT-PCR	32835083
MIRT733239	hsa-miR-126-3p	Immunohistochemistry (IHC)In situ hybridizationMicroarray	34055877
MIRT733240	hsa-miR-20b-3p	Immunohistochemistry (IHC)In situ hybridizationMicroarray	34055877
MIRT391240	hsa-miR-192-3p	Luciferase reporter assayWestern blottingRNA-seqqRT-PCR	33134908
MIRT687449	hsa-miR-138-5p	HITS-CLIP	23313552
MIRT687448	hsa-miR-137	HITS-CLIP	23313552
MIRT095604	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT687447	hsa-miR-6800-3p	HITS-CLIP	23313552
MIRT214865	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT095600	hsa-miR-4699-3p	HITS-CLIP	23313552
MIRT687446	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT095597	hsa-miR-1279	HITS-CLIP	23313552
MIRT687445	hsa-miR-3130-3p	HITS-CLIP	23313552
MIRT687444	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT687443	hsa-miR-3182	HITS-CLIP	23313552
MIRT687442	hsa-miR-3928-5p	HITS-CLIP	23313552
MIRT687441	hsa-miR-6806-3p	HITS-CLIP	23313552
MIRT687440	hsa-miR-5186	HITS-CLIP	23313552
MIRT687439	hsa-miR-133a-5p	HITS-CLIP	23313552
MIRT687438	hsa-miR-6131	HITS-CLIP	23313552
MIRT687437	hsa-miR-196a-3p	HITS-CLIP	23313552
MIRT687436	hsa-miR-496	HITS-CLIP	23313552
MIRT687435	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT687434	hsa-miR-127-5p	HITS-CLIP	23313552
MIRT391240	hsa-miR-192-3p	HITS-CLIP	23313552
MIRT687433	hsa-miR-1263	HITS-CLIP	23313552
MIRT687432	hsa-miR-544a	HITS-CLIP	23313552
MIRT687431	hsa-miR-4652-3p	HITS-CLIP	23313552
MIRT687430	hsa-miR-182-5p	HITS-CLIP	23313552
MIRT687429	hsa-miR-6868-3p	HITS-CLIP	23313552
MIRT566613	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT440092	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT566612	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT312331	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT566611	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT566610	hsa-miR-1179	PAR-CLIP	20371350
MIRT214857	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT566609	hsa-miR-5692b	PAR-CLIP	20371350
MIRT566608	hsa-miR-5692c	PAR-CLIP	20371350
MIRT329361	hsa-miR-4528	PAR-CLIP	20371350
MIRT095611	hsa-miR-4672	PAR-CLIP	20371350
MIRT566607	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT095612	hsa-miR-5590-5p	PAR-CLIP	20371350
MIRT566606	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT566605	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT566604	hsa-miR-2355-3p	PAR-CLIP	20371350
MIRT378074	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT214899	hsa-miR-618	PAR-CLIP	21572407
MIRT555970	hsa-miR-6757-5p	PAR-CLIP	21572407
MIRT555969	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT555968	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT555967	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT555966	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT555964	hsa-miR-3162-5p	PAR-CLIP	21572407
MIRT471981	hsa-miR-4282	PAR-CLIP	23592263
MIRT471980	hsa-miR-8485	PAR-CLIP	23592263
MIRT471979	hsa-miR-329-3p	PAR-CLIP	23592263
MIRT471978	hsa-miR-362-3p	PAR-CLIP	23592263
MIRT471977	hsa-miR-603	PAR-CLIP	23592263
MIRT471976	hsa-miR-5582-5p	PAR-CLIP	23592263
MIRT471975	hsa-miR-3622a-5p	PAR-CLIP	23592263
MIRT471974	hsa-miR-5586-5p	PAR-CLIP	23592263
MIRT471973	hsa-miR-6849-3p	PAR-CLIP	23592263
MIRT471972	hsa-miR-125b-1-3p	PAR-CLIP	23592263
MIRT471971	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT095609	hsa-miR-3941	PAR-CLIP	23592263
MIRT095608	hsa-miR-466	PAR-CLIP	23592263
MIRT471970	hsa-miR-4423-3p	PAR-CLIP	23592263
MIRT471969	hsa-miR-6512-3p	PAR-CLIP	23592263
MIRT471968	hsa-miR-6720-5p	PAR-CLIP	23592263
MIRT004546	hsa-miR-124-3p	Luciferase reporter assayWestern blottingqRT-PCR	35270010
MIRT1192606	hsa-miR-144	CLIP-seq
MIRT1192607	hsa-miR-3143	CLIP-seq
MIRT1192608	hsa-miR-3607-3p	CLIP-seq
MIRT1192609	hsa-miR-365	CLIP-seq
MIRT1192610	hsa-miR-374a	CLIP-seq
MIRT1192611	hsa-miR-374b	CLIP-seq
MIRT1192612	hsa-miR-4694-3p	CLIP-seq
MIRT1192613	hsa-miR-4718	CLIP-seq
MIRT1192614	hsa-miR-522	CLIP-seq
MIRT1192615	hsa-miR-543	CLIP-seq
MIRT1192616	hsa-miR-1207-3p	CLIP-seq
MIRT1192617	hsa-miR-1231	CLIP-seq
MIRT1192618	hsa-miR-1258	CLIP-seq
MIRT1192619	hsa-miR-1283	CLIP-seq
MIRT1192620	hsa-miR-1299	CLIP-seq
MIRT1192621	hsa-miR-1303	CLIP-seq
MIRT1192622	hsa-miR-1305	CLIP-seq
MIRT1192623	hsa-miR-150	CLIP-seq
MIRT1192624	hsa-miR-181a	CLIP-seq
MIRT1192625	hsa-miR-181b	CLIP-seq
MIRT1192626	hsa-miR-181c	CLIP-seq
MIRT1192627	hsa-miR-181d	CLIP-seq
MIRT1192628	hsa-miR-197	CLIP-seq
MIRT1192629	hsa-miR-204	CLIP-seq
MIRT1192630	hsa-miR-2053	CLIP-seq
MIRT1192631	hsa-miR-211	CLIP-seq
MIRT1192632	hsa-miR-30a	CLIP-seq
MIRT1192633	hsa-miR-30b	CLIP-seq
MIRT1192634	hsa-miR-30c	CLIP-seq
MIRT1192635	hsa-miR-30d	CLIP-seq
MIRT1192636	hsa-miR-30e	CLIP-seq
MIRT1192637	hsa-miR-3117-3p	CLIP-seq
MIRT1192638	hsa-miR-3122	CLIP-seq
MIRT1192639	hsa-miR-3125	CLIP-seq
MIRT1192640	hsa-miR-3126-3p	CLIP-seq
MIRT1192641	hsa-miR-3129-3p	CLIP-seq
MIRT1192642	hsa-miR-3153	CLIP-seq
MIRT1192643	hsa-miR-3163	CLIP-seq
MIRT1192644	hsa-miR-3169	CLIP-seq
MIRT1192645	hsa-miR-3185	CLIP-seq
MIRT1192646	hsa-miR-3192	CLIP-seq
MIRT1192647	hsa-miR-3200-5p	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT1192649	hsa-miR-3662	CLIP-seq
MIRT1192650	hsa-miR-3913-5p	CLIP-seq
MIRT1192651	hsa-miR-3916	CLIP-seq
MIRT1192652	hsa-miR-3920	CLIP-seq
MIRT1192653	hsa-miR-409-3p	CLIP-seq
MIRT1192654	hsa-miR-410	CLIP-seq
MIRT1192655	hsa-miR-4262	CLIP-seq
MIRT1192656	hsa-miR-4288	CLIP-seq
MIRT1192657	hsa-miR-4310	CLIP-seq
MIRT1192658	hsa-miR-4314	CLIP-seq
MIRT1192659	hsa-miR-433	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT1192661	hsa-miR-4517	CLIP-seq
MIRT1192662	hsa-miR-4646-5p	CLIP-seq
MIRT1192663	hsa-miR-4668-5p	CLIP-seq
MIRT1192664	hsa-miR-4709-5p	CLIP-seq
MIRT1192665	hsa-miR-4712-3p	CLIP-seq
MIRT1192666	hsa-miR-4713-5p	CLIP-seq
MIRT1192667	hsa-miR-4735-5p	CLIP-seq
MIRT1192668	hsa-miR-4738-3p	CLIP-seq
MIRT1192669	hsa-miR-4759	CLIP-seq
MIRT1192670	hsa-miR-4762-3p	CLIP-seq
MIRT1192671	hsa-miR-4766-5p	CLIP-seq
MIRT1192672	hsa-miR-4775	CLIP-seq
MIRT1192673	hsa-miR-4789-5p	CLIP-seq
MIRT1192674	hsa-miR-485-3p	CLIP-seq
MIRT1192675	hsa-miR-507	CLIP-seq
MIRT1192676	hsa-miR-5096	CLIP-seq
MIRT1192677	hsa-miR-513a-3p	CLIP-seq
MIRT1192678	hsa-miR-532-3p	CLIP-seq
MIRT1192679	hsa-miR-544	CLIP-seq
MIRT1192680	hsa-miR-548ah	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT1192682	hsa-miR-548t	CLIP-seq
MIRT1192683	hsa-miR-557	CLIP-seq
MIRT1192684	hsa-miR-569	CLIP-seq
MIRT1192685	hsa-miR-587	CLIP-seq
MIRT1192686	hsa-miR-632	CLIP-seq
MIRT1192687	hsa-miR-656	CLIP-seq
MIRT1192688	hsa-miR-875-3p	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192690	hsa-miR-1185	CLIP-seq
MIRT1192691	hsa-miR-1208	CLIP-seq
MIRT1192692	hsa-miR-1225-5p	CLIP-seq
MIRT1192693	hsa-miR-1253	CLIP-seq
MIRT1192694	hsa-miR-1267	CLIP-seq
MIRT1192695	hsa-miR-1275	CLIP-seq
MIRT1192696	hsa-miR-1293	CLIP-seq
MIRT1192697	hsa-miR-129-5p	CLIP-seq
MIRT1192621	hsa-miR-1303	CLIP-seq
MIRT1192698	hsa-miR-139-5p	CLIP-seq
MIRT1192699	hsa-miR-1827	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192701	hsa-miR-216a	CLIP-seq
MIRT1192702	hsa-miR-216b	CLIP-seq
MIRT1192703	hsa-miR-2467-3p	CLIP-seq
MIRT1192704	hsa-miR-297	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT1192639	hsa-miR-3125	CLIP-seq
MIRT1192706	hsa-miR-3154	CLIP-seq
MIRT1192707	hsa-miR-3174	CLIP-seq
MIRT1192708	hsa-miR-323-5p	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT1192710	hsa-miR-3591-5p	CLIP-seq
MIRT1192711	hsa-miR-3606	CLIP-seq
MIRT1192608	hsa-miR-3607-3p	CLIP-seq
MIRT1192712	hsa-miR-3612	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT1192713	hsa-miR-3673	CLIP-seq
MIRT1192714	hsa-miR-3679-5p	CLIP-seq
MIRT1192715	hsa-miR-3686	CLIP-seq
MIRT1192716	hsa-miR-3689a-3p	CLIP-seq
MIRT1192717	hsa-miR-3689c	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT1192651	hsa-miR-3916	CLIP-seq
MIRT1192719	hsa-miR-4272	CLIP-seq
MIRT1192720	hsa-miR-4422	CLIP-seq
MIRT1192721	hsa-miR-4436a	CLIP-seq
MIRT1192722	hsa-miR-4446-3p	CLIP-seq
MIRT1192723	hsa-miR-4483	CLIP-seq
MIRT1192724	hsa-miR-4501	CLIP-seq
MIRT1192725	hsa-miR-4525	CLIP-seq
MIRT1192726	hsa-miR-4659a-5p	CLIP-seq
MIRT1192727	hsa-miR-4659b-5p	CLIP-seq
MIRT1192728	hsa-miR-4665-5p	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT1192730	hsa-miR-4675	CLIP-seq
MIRT1192731	hsa-miR-4700-3p	CLIP-seq
MIRT1192732	hsa-miR-4721	CLIP-seq
MIRT1192733	hsa-miR-4723-5p	CLIP-seq
MIRT1192734	hsa-miR-4728-5p	CLIP-seq
MIRT1192735	hsa-miR-4731-5p	CLIP-seq
MIRT1192736	hsa-miR-4741	CLIP-seq
MIRT1192737	hsa-miR-4776-3p	CLIP-seq
MIRT1192673	hsa-miR-4789-5p	CLIP-seq
MIRT1192738	hsa-miR-548a-5p	CLIP-seq
MIRT1192739	hsa-miR-548ab	CLIP-seq
MIRT1192740	hsa-miR-548ak	CLIP-seq
MIRT1192741	hsa-miR-548b-5p	CLIP-seq
MIRT1192742	hsa-miR-548c-5p	CLIP-seq
MIRT1192743	hsa-miR-548d-5p	CLIP-seq
MIRT1192744	hsa-miR-548h	CLIP-seq
MIRT1192745	hsa-miR-548i	CLIP-seq
MIRT1192746	hsa-miR-548j	CLIP-seq
MIRT1192747	hsa-miR-548w	CLIP-seq
MIRT1192748	hsa-miR-548y	CLIP-seq
MIRT1192749	hsa-miR-555	CLIP-seq
MIRT1192750	hsa-miR-559	CLIP-seq
MIRT1192751	hsa-miR-561	CLIP-seq
MIRT1192752	hsa-miR-567	CLIP-seq
MIRT1192753	hsa-miR-570	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq
MIRT1192755	hsa-miR-616	CLIP-seq
MIRT1192756	hsa-miR-625	CLIP-seq
MIRT1192757	hsa-miR-637	CLIP-seq
MIRT1192758	hsa-miR-650	CLIP-seq
MIRT1192759	hsa-miR-921	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2055944	hsa-miR-1224-5p	CLIP-seq
MIRT1192692	hsa-miR-1225-5p	CLIP-seq
MIRT1192618	hsa-miR-1258	CLIP-seq
MIRT2055945	hsa-miR-1284	CLIP-seq
MIRT2055946	hsa-miR-1304	CLIP-seq
MIRT2055947	hsa-miR-200b	CLIP-seq
MIRT2055948	hsa-miR-200c	CLIP-seq
MIRT1192637	hsa-miR-3117-3p	CLIP-seq
MIRT2055949	hsa-miR-3150b-3p	CLIP-seq
MIRT1192644	hsa-miR-3169	CLIP-seq
MIRT2055950	hsa-miR-3654	CLIP-seq
MIRT2055951	hsa-miR-3668	CLIP-seq
MIRT2055952	hsa-miR-378	CLIP-seq
MIRT2055953	hsa-miR-378b	CLIP-seq
MIRT2055954	hsa-miR-378c	CLIP-seq
MIRT2055955	hsa-miR-378d	CLIP-seq
MIRT2055956	hsa-miR-378e	CLIP-seq
MIRT2055957	hsa-miR-378f	CLIP-seq
MIRT2055958	hsa-miR-378h	CLIP-seq
MIRT2055959	hsa-miR-378i	CLIP-seq
MIRT2055960	hsa-miR-3907	CLIP-seq
MIRT2055961	hsa-miR-3915	CLIP-seq
MIRT1192654	hsa-miR-410	CLIP-seq
MIRT2055962	hsa-miR-422a	CLIP-seq
MIRT2055963	hsa-miR-429	CLIP-seq
MIRT2055964	hsa-miR-4503	CLIP-seq
MIRT2055965	hsa-miR-4689	CLIP-seq
MIRT2055966	hsa-miR-4703-3p	CLIP-seq
MIRT1192734	hsa-miR-4728-5p	CLIP-seq
MIRT1192669	hsa-miR-4759	CLIP-seq
MIRT1192672	hsa-miR-4775	CLIP-seq
MIRT2055967	hsa-miR-4779	CLIP-seq
MIRT2055968	hsa-miR-4784	CLIP-seq
MIRT2055969	hsa-miR-515-5p	CLIP-seq
MIRT1192749	hsa-miR-555	CLIP-seq
MIRT1192751	hsa-miR-561	CLIP-seq
MIRT2055970	hsa-miR-606	CLIP-seq
MIRT1192619	hsa-miR-1283	CLIP-seq
MIRT2055945	hsa-miR-1284	CLIP-seq
MIRT1192622	hsa-miR-1305	CLIP-seq
MIRT2055971	hsa-miR-1324	CLIP-seq
MIRT2055972	hsa-miR-142-5p	CLIP-seq
MIRT2055973	hsa-miR-29a	CLIP-seq
MIRT2055974	hsa-miR-29b	CLIP-seq
MIRT2055975	hsa-miR-29c	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT1192643	hsa-miR-3163	CLIP-seq
MIRT2055976	hsa-miR-340	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT1192654	hsa-miR-410	CLIP-seq
MIRT2055977	hsa-miR-4328	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2055978	hsa-miR-4433	CLIP-seq
MIRT2055979	hsa-miR-4435	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT1192731	hsa-miR-4700-3p	CLIP-seq
MIRT2055966	hsa-miR-4703-3p	CLIP-seq
MIRT2055980	hsa-miR-4719	CLIP-seq
MIRT1192670	hsa-miR-4762-3p	CLIP-seq
MIRT1192672	hsa-miR-4775	CLIP-seq
MIRT2055981	hsa-miR-545	CLIP-seq
MIRT2055982	hsa-miR-548aa	CLIP-seq
MIRT2055983	hsa-miR-548s	CLIP-seq
MIRT2055984	hsa-miR-582-5p	CLIP-seq
MIRT2055973	hsa-miR-29a	CLIP-seq
MIRT2055974	hsa-miR-29b	CLIP-seq
MIRT2055975	hsa-miR-29c	CLIP-seq
MIRT2284662	hsa-miR-3689a-5p	CLIP-seq
MIRT2284663	hsa-miR-3689b	CLIP-seq
MIRT2284664	hsa-miR-3689e	CLIP-seq
MIRT2284665	hsa-miR-3689f	CLIP-seq
MIRT2284666	hsa-miR-4318	CLIP-seq
MIRT2284667	hsa-miR-4425	CLIP-seq
MIRT2284668	hsa-miR-4427	CLIP-seq
MIRT2055979	hsa-miR-4435	CLIP-seq
MIRT2284669	hsa-miR-450b-3p	CLIP-seq
MIRT2284670	hsa-miR-4679	CLIP-seq
MIRT2284671	hsa-miR-4680-3p	CLIP-seq
MIRT2284672	hsa-miR-4693-5p	CLIP-seq
MIRT1192672	hsa-miR-4775	CLIP-seq
MIRT2284673	hsa-miR-4789-3p	CLIP-seq
MIRT1192755	hsa-miR-616	CLIP-seq
MIRT2284674	hsa-miR-769-3p	CLIP-seq
MIRT2284675	hsa-miR-892a	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2431623	hsa-miR-199a-3p	CLIP-seq
MIRT2431624	hsa-miR-199b-3p	CLIP-seq
MIRT2431625	hsa-miR-3074-5p	CLIP-seq
MIRT2431626	hsa-miR-3124-3p	CLIP-seq
MIRT2431627	hsa-miR-3129-5p	CLIP-seq
MIRT2431628	hsa-miR-3168	CLIP-seq
MIRT2431629	hsa-miR-4277	CLIP-seq
MIRT2431630	hsa-miR-4663	CLIP-seq
MIRT2055980	hsa-miR-4719	CLIP-seq
MIRT2431631	hsa-miR-4799-5p	CLIP-seq
MIRT2431632	hsa-miR-486-5p	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT2055984	hsa-miR-582-5p	CLIP-seq
MIRT2431633	hsa-miR-936	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT2582465	hsa-miR-3647-3p	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT2582466	hsa-miR-500a	CLIP-seq
MIRT2582467	hsa-miR-568	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192690	hsa-miR-1185	CLIP-seq
MIRT1192691	hsa-miR-1208	CLIP-seq
MIRT2582468	hsa-miR-124	CLIP-seq
MIRT2582469	hsa-miR-1245b-3p	CLIP-seq
MIRT1192693	hsa-miR-1253	CLIP-seq
MIRT2582470	hsa-miR-1264	CLIP-seq
MIRT1192694	hsa-miR-1267	CLIP-seq
MIRT2582471	hsa-miR-1291	CLIP-seq
MIRT1192696	hsa-miR-1293	CLIP-seq
MIRT1192697	hsa-miR-129-5p	CLIP-seq
MIRT2582472	hsa-miR-1298	CLIP-seq
MIRT1192620	hsa-miR-1299	CLIP-seq
MIRT1192698	hsa-miR-139-5p	CLIP-seq
MIRT2582473	hsa-miR-142-3p	CLIP-seq
MIRT2582474	hsa-miR-154	CLIP-seq
MIRT1192624	hsa-miR-181a	CLIP-seq
MIRT1192625	hsa-miR-181b	CLIP-seq
MIRT1192626	hsa-miR-181c	CLIP-seq
MIRT1192627	hsa-miR-181d	CLIP-seq
MIRT1192699	hsa-miR-1827	CLIP-seq
MIRT2431623	hsa-miR-199a-3p	CLIP-seq
MIRT2431624	hsa-miR-199b-3p	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192701	hsa-miR-216a	CLIP-seq
MIRT1192702	hsa-miR-216b	CLIP-seq
MIRT1192703	hsa-miR-2467-3p	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT2582475	hsa-miR-3065-5p	CLIP-seq
MIRT2431625	hsa-miR-3074-5p	CLIP-seq
MIRT2582476	hsa-miR-3119	CLIP-seq
MIRT2431626	hsa-miR-3124-3p	CLIP-seq
MIRT2582477	hsa-miR-3127-5p	CLIP-seq
MIRT2431627	hsa-miR-3129-5p	CLIP-seq
MIRT1192607	hsa-miR-3143	CLIP-seq
MIRT1192706	hsa-miR-3154	CLIP-seq
MIRT1192643	hsa-miR-3163	CLIP-seq
MIRT2431628	hsa-miR-3168	CLIP-seq
MIRT2582478	hsa-miR-3171	CLIP-seq
MIRT2582479	hsa-miR-3179	CLIP-seq
MIRT1192708	hsa-miR-323-5p	CLIP-seq
MIRT2582480	hsa-miR-328	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT2582481	hsa-miR-339-3p	CLIP-seq
MIRT1192608	hsa-miR-3607-3p	CLIP-seq
MIRT1192712	hsa-miR-3612	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT2582465	hsa-miR-3647-3p	CLIP-seq
MIRT2055950	hsa-miR-3654	CLIP-seq
MIRT1192713	hsa-miR-3673	CLIP-seq
MIRT1192714	hsa-miR-3679-5p	CLIP-seq
MIRT2582482	hsa-miR-3680	CLIP-seq
MIRT1192715	hsa-miR-3686	CLIP-seq
MIRT2582483	hsa-miR-3688-3p	CLIP-seq
MIRT1192716	hsa-miR-3689a-3p	CLIP-seq
MIRT1192717	hsa-miR-3689c	CLIP-seq
MIRT2582484	hsa-miR-3691-3p	CLIP-seq
MIRT2582485	hsa-miR-3714	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT2582486	hsa-miR-3910	CLIP-seq
MIRT2582487	hsa-miR-3918	CLIP-seq
MIRT2582488	hsa-miR-3978	CLIP-seq
MIRT1192655	hsa-miR-4262	CLIP-seq
MIRT2582489	hsa-miR-4270	CLIP-seq
MIRT2431629	hsa-miR-4277	CLIP-seq
MIRT1192657	hsa-miR-4310	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2582490	hsa-miR-4423-5p	CLIP-seq
MIRT2582491	hsa-miR-4426	CLIP-seq
MIRT2284668	hsa-miR-4427	CLIP-seq
MIRT2582492	hsa-miR-4441	CLIP-seq
MIRT2582493	hsa-miR-4452	CLIP-seq
MIRT2582494	hsa-miR-4471	CLIP-seq
MIRT2582495	hsa-miR-4477b	CLIP-seq
MIRT2582496	hsa-miR-4480	CLIP-seq
MIRT1192723	hsa-miR-4483	CLIP-seq
MIRT2582497	hsa-miR-4493	CLIP-seq
MIRT2582498	hsa-miR-4512	CLIP-seq
MIRT2582499	hsa-miR-4647	CLIP-seq
MIRT2582500	hsa-miR-4662b	CLIP-seq
MIRT2431630	hsa-miR-4663	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT2284671	hsa-miR-4680-3p	CLIP-seq
MIRT1192731	hsa-miR-4700-3p	CLIP-seq
MIRT2055966	hsa-miR-4703-3p	CLIP-seq
MIRT2055980	hsa-miR-4719	CLIP-seq
MIRT1192734	hsa-miR-4728-5p	CLIP-seq
MIRT2582501	hsa-miR-4757-5p	CLIP-seq
MIRT2582502	hsa-miR-4778-3p	CLIP-seq
MIRT2582503	hsa-miR-4782-5p	CLIP-seq
MIRT2582504	hsa-miR-4786-5p	CLIP-seq
MIRT1192673	hsa-miR-4789-5p	CLIP-seq
MIRT2431631	hsa-miR-4799-5p	CLIP-seq
MIRT2431632	hsa-miR-486-5p	CLIP-seq
MIRT2582505	hsa-miR-495	CLIP-seq
MIRT2582466	hsa-miR-500a	CLIP-seq
MIRT2582506	hsa-miR-506	CLIP-seq
MIRT2582507	hsa-miR-514	CLIP-seq
MIRT2582508	hsa-miR-514b-3p	CLIP-seq
MIRT2582509	hsa-miR-516b	CLIP-seq
MIRT1192615	hsa-miR-543	CLIP-seq
MIRT2055981	hsa-miR-545	CLIP-seq
MIRT1192680	hsa-miR-548ah	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT1192682	hsa-miR-548t	CLIP-seq
MIRT2582510	hsa-miR-548v	CLIP-seq
MIRT2582467	hsa-miR-568	CLIP-seq
MIRT1192753	hsa-miR-570	CLIP-seq
MIRT2055984	hsa-miR-582-5p	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq
MIRT2582511	hsa-miR-639	CLIP-seq
MIRT1192758	hsa-miR-650	CLIP-seq
MIRT2582512	hsa-miR-769-5p	CLIP-seq
MIRT1192688	hsa-miR-875-3p	CLIP-seq
MIRT2431633	hsa-miR-936	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192690	hsa-miR-1185	CLIP-seq
MIRT1192691	hsa-miR-1208	CLIP-seq
MIRT2582469	hsa-miR-1245b-3p	CLIP-seq
MIRT1192693	hsa-miR-1253	CLIP-seq
MIRT2582470	hsa-miR-1264	CLIP-seq
MIRT1192694	hsa-miR-1267	CLIP-seq
MIRT1192619	hsa-miR-1283	CLIP-seq
MIRT2582471	hsa-miR-1291	CLIP-seq
MIRT1192696	hsa-miR-1293	CLIP-seq
MIRT1192697	hsa-miR-129-5p	CLIP-seq
MIRT2582472	hsa-miR-1298	CLIP-seq
MIRT1192698	hsa-miR-139-5p	CLIP-seq
MIRT2582473	hsa-miR-142-3p	CLIP-seq
MIRT2582474	hsa-miR-154	CLIP-seq
MIRT1192624	hsa-miR-181a	CLIP-seq
MIRT1192625	hsa-miR-181b	CLIP-seq
MIRT1192626	hsa-miR-181c	CLIP-seq
MIRT1192627	hsa-miR-181d	CLIP-seq
MIRT1192699	hsa-miR-1827	CLIP-seq
MIRT2431623	hsa-miR-199a-3p	CLIP-seq
MIRT2431624	hsa-miR-199b-3p	CLIP-seq
MIRT2686538	hsa-miR-205	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192701	hsa-miR-216a	CLIP-seq
MIRT1192702	hsa-miR-216b	CLIP-seq
MIRT1192703	hsa-miR-2467-3p	CLIP-seq
MIRT2431625	hsa-miR-3074-5p	CLIP-seq
MIRT2582476	hsa-miR-3119	CLIP-seq
MIRT2431626	hsa-miR-3124-3p	CLIP-seq
MIRT2582477	hsa-miR-3127-5p	CLIP-seq
MIRT2431627	hsa-miR-3129-5p	CLIP-seq
MIRT1192706	hsa-miR-3154	CLIP-seq
MIRT2431628	hsa-miR-3168	CLIP-seq
MIRT2582478	hsa-miR-3171	CLIP-seq
MIRT2582479	hsa-miR-3179	CLIP-seq
MIRT1192708	hsa-miR-323-5p	CLIP-seq
MIRT2582480	hsa-miR-328	CLIP-seq
MIRT2686539	hsa-miR-338-3p	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT1192608	hsa-miR-3607-3p	CLIP-seq
MIRT1192712	hsa-miR-3612	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT2686540	hsa-miR-3622b-5p	CLIP-seq
MIRT2582465	hsa-miR-3647-3p	CLIP-seq
MIRT2686541	hsa-miR-3670	CLIP-seq
MIRT1192713	hsa-miR-3673	CLIP-seq
MIRT1192714	hsa-miR-3679-5p	CLIP-seq
MIRT2582482	hsa-miR-3680	CLIP-seq
MIRT1192715	hsa-miR-3686	CLIP-seq
MIRT2582483	hsa-miR-3688-3p	CLIP-seq
MIRT1192716	hsa-miR-3689a-3p	CLIP-seq
MIRT1192717	hsa-miR-3689c	CLIP-seq
MIRT2582484	hsa-miR-3691-3p	CLIP-seq
MIRT2582487	hsa-miR-3918	CLIP-seq
MIRT1192654	hsa-miR-410	CLIP-seq
MIRT1192655	hsa-miR-4262	CLIP-seq
MIRT2582489	hsa-miR-4270	CLIP-seq
MIRT2431629	hsa-miR-4277	CLIP-seq
MIRT1192657	hsa-miR-4310	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2582490	hsa-miR-4423-5p	CLIP-seq
MIRT2582491	hsa-miR-4426	CLIP-seq
MIRT2284668	hsa-miR-4427	CLIP-seq
MIRT2582492	hsa-miR-4441	CLIP-seq
MIRT2582493	hsa-miR-4452	CLIP-seq
MIRT2582494	hsa-miR-4471	CLIP-seq
MIRT2686542	hsa-miR-4474-5p	CLIP-seq
MIRT2582496	hsa-miR-4480	CLIP-seq
MIRT1192723	hsa-miR-4483	CLIP-seq
MIRT2686543	hsa-miR-450b-5p	CLIP-seq
MIRT2582498	hsa-miR-4512	CLIP-seq
MIRT2686544	hsa-miR-4530	CLIP-seq
MIRT2582499	hsa-miR-4647	CLIP-seq
MIRT2582500	hsa-miR-4662b	CLIP-seq
MIRT2431630	hsa-miR-4663	CLIP-seq
MIRT2284671	hsa-miR-4680-3p	CLIP-seq
MIRT2055966	hsa-miR-4703-3p	CLIP-seq
MIRT2055980	hsa-miR-4719	CLIP-seq
MIRT1192734	hsa-miR-4728-5p	CLIP-seq
MIRT2582501	hsa-miR-4757-5p	CLIP-seq
MIRT2582504	hsa-miR-4786-5p	CLIP-seq
MIRT2431631	hsa-miR-4799-5p	CLIP-seq
MIRT2431632	hsa-miR-486-5p	CLIP-seq
MIRT2582466	hsa-miR-500a	CLIP-seq
MIRT1192675	hsa-miR-507	CLIP-seq
MIRT2686545	hsa-miR-542-3p	CLIP-seq
MIRT2055981	hsa-miR-545	CLIP-seq
MIRT1192680	hsa-miR-548ah	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT1192682	hsa-miR-548t	CLIP-seq
MIRT2582510	hsa-miR-548v	CLIP-seq
MIRT1192683	hsa-miR-557	CLIP-seq
MIRT2582467	hsa-miR-568	CLIP-seq
MIRT1192753	hsa-miR-570	CLIP-seq
MIRT2055984	hsa-miR-582-5p	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq
MIRT2582511	hsa-miR-639	CLIP-seq
MIRT1192758	hsa-miR-650	CLIP-seq
MIRT2582512	hsa-miR-769-5p	CLIP-seq
MIRT2686546	hsa-miR-873	CLIP-seq
MIRT2431633	hsa-miR-936	CLIP-seq
MIRT2686547	hsa-miR-944	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192701	hsa-miR-216a	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
CLOCK	Repression	21164265
HIF1A	Unknown	15699159
MYB	Unknown	22516378
NR3C1	Unknown	22516378
TFAP2A	Activation	7794935
YY1	Unknown	10030686

102

Show/Hide all (102)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	1894621
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12902338
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	1894621
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16728402
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001046	Function	Core promoter sequence-specific DNA binding	IDA	17081986
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	1894621
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16728402, 23823477, 28139699
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15769988
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7769088, 10903900
GO:0003723	Function	RNA binding	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	17635946
GO:0004883	Function	Nuclear glucocorticoid receptor activity	IEA
GO:0004883	Function	Nuclear glucocorticoid receptor activity	TAS	8621628
GO:0005496	Function	Steroid binding	IDA	15769988
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	9079630, 10364267, 11266503, 12552091, 12773562, 12902338, 15591535, 15769988, 15941832, 16606617, 16619302, 16888650, 17003263, 17635946, 17978169, 19141540, 19841061, 20195357, 20211142, 21980503, 22170608, 24291004, 24658140, 24949977, 26031419, 27353360, 31467278, 31980649, 3281
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	1894621
GO:0005634	Component	Nucleus	IDA	28139699
GO:0005634	Component	Nucleus	IDA	9353307, 15769988, 17635946, 22022502, 23878391
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9873044
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	15769988, 17635946, 22022502
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9873044
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS	10887960
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	17081986, 19141540
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007165	Process	Signal transduction	TAS	7769088
GO:0008211	Process	Glucocorticoid metabolic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0010467	Process	Gene expression	IEA
GO:0014004	Process	Microglia differentiation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IDA	9353307
GO:0017025	Function	TBP-class protein binding	IPI	19841061
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	20371704
GO:0030325	Process	Adrenal gland development	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IBA
GO:0031946	Process	Regulation of glucocorticoid biosynthetic process	IEA
GO:0031958	Process	Nuclear receptor-mediated corticosteroid signaling pathway	IEA
GO:0032991	Component	Protein-containing complex	IDA	26593036
GO:0034056	Function	Estrogen response element binding	IBA
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042921	Process	Nuclear receptor-mediated glucocorticoid signaling pathway	IEA
GO:0042921	Process	Nuclear receptor-mediated glucocorticoid signaling pathway	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	1894621
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15769988, 16728402, 23823477
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	9353307
GO:0046872	Function	Metal ion binding	IEA
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0051301	Process	Cell division	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051414	Process	Response to cortisol	IEA
GO:0051879	Function	Hsp90 protein binding	IPI	26593036
GO:0060603	Process	Mammary gland duct morphogenesis	IEA
GO:0061744	Process	Motor behavior	IEA
GO:0071383	Process	Cellular response to steroid hormone stimulus	IDA	15769988, 17635946
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IDA	9353307, 28139699
GO:0071549	Process	Cellular response to dexamethasone stimulus	IMP	12902338
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IDA	12902338
GO:0150076	Process	Neuroinflammatory response	IEA
GO:1901654	Process	Response to ketone	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	27334923
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1990239	Function	Steroid hormone binding	IDA	17635946
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
138040	7978	ENSG00000113580

P04150

Protein name

Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)

Protein function

Receptor for glucocorticoids (GC) (PubMed:27120390, PubMed:37478846). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other

PDB

1M2Z , 1NHZ , 1P93 , 3BQD , 3CLD , 3E7C , 3H52 , 3K22 , 3K23 , 4CSJ , 4HN5 , 4HN6 , 4LSJ , 4MDD , 4P6W , 4P6X , 4UDC , 4UDD , 5CBX , 5CBY , 5CBZ , 5CC1 , 5E69 , 5E6A , 5E6B , 5E6C , 5E6D , 5EMC , 5EMP , 5EMQ , 5G3J , 5G5W , 5NFP , 5NFT , 5UC1 , 5UC3 , 5VA0 , 5VA7 , 6BQU , 6CFN , 6DXK , 6EL6 , 6EL7 , 6EL9 , 6X6D , 6X6E , 6YMO , 6YO8 , 6YOS , 7KRJ , 7KW7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02155	GCR	26 → 401	Glucocorticoid receptor	Family
PF00105	zf-C4	419 → 488	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	549 → 741	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed including bone, stomach, lung, liver, colon, breast, ovary, pancreas and kidney (PubMed:25847991). In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and at

Sequence

MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Sequence length

777

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		HSP90 chaperone cycle for steroid hormone receptors (SHR) Nuclear Receptor transcription pathway SUMOylation of intracellular receptors PTK6 Expression

185

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Glucocorticoid resistance	Likely pathogenic; Pathogenic	rs770466966, rs104893908, rs587776832, rs104893909, rs104893910, rs104893912, rs121909727	RCV003135489 RCV000017529 RCV000017530 RCV000017533 RCV000017534 RCV000017538 RCV000017541
GLUCOCORTICOID RESISTANCE, ATYPICAL	Pathogenic	rs104893911	RCV000017535
GLUCOCORTICOID RESISTANCE, CELLULAR	Pathogenic	rs121909726	RCV000017531

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign; Likely benign	rs72542757	RCV005898931
GLUCOCORTICOID RESISTANCE, MILD	Uncertain significance	rs2151942107	RCV003388938
Hepatocellular carcinoma	Benign; Likely benign	rs72542757	RCV005898929
Malignant tumor of esophagus	Benign; Likely benign	rs72542757	RCV005898930
NR3C1 POLYMORPHISM	Benign; Likely benign	rs56149945	RCV000017532
NR3C1-related disorder	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	rs6190, rs2540766684, rs258751, rs10482622, rs200468789, rs6189	RCV003912497 RCV003402927 RCV003970021 RCV003970022 RCV004756542 RCV003905247
Prostate cancer	Uncertain significance	rs193921137	RCV000149029
Uterine corpus endometrial carcinoma	Benign; Likely benign	rs72542757	RCV005898932

Show/Hide Text Mining Associations (329)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abdominal Injuries	Associate	22587831
Abdominal Pain	Associate	27038676
ACTH Secreting Pituitary Adenoma	Associate	36640905
Acute Coronary Syndrome	Associate	32218512
Acute On Chronic Liver Failure	Inhibit	31628069
Acute Pain	Associate	30079801
Addison Disease	Associate	22587831
Adenocarcinoma	Associate	33494362, 34417596
Adenocarcinoma of Lung	Associate	26402252, 30375484
Adenoma	Associate	17167179, 23196783, 23548621, 24472434, 9506748
Adenoma	Inhibit	35270010
Adenomatous Polyposis Coli	Associate	24472434
Adrenal Gland Neoplasms	Associate	35120172
Adrenal Hyperplasia Congenital	Associate	21042587
Adrenal incidentaloma	Associate	23196783
Adrenal Insufficiency	Associate	29796117, 37409973
Adrenocortical Carcinoma	Associate	35992138, 37793855
Age Related Hearing Impairment 1	Associate	34320993
Aging Premature	Associate	35069971
Agnosia	Associate	38482990
Aicardi Syndrome	Inhibit	35992138
Airway Obstruction	Associate	25564524
Allergic Fungal Sinusitis	Associate	35690807
Alzheimer Disease	Associate	34697589, 39796199
Amyotrophic Lateral Sclerosis	Associate	32732921
Androgen Insensitivity Syndrome	Associate	33284958, 8647313
Anemia Sickle Cell	Associate	30079801
Angioedemas Hereditary	Associate	28069032
Anhedonia	Associate	39778819
Anxiety	Stimulate	29100173
Anxiety	Associate	32957930, 33215541, 33373777, 33762648, 34572069, 34715840, 39778819
Anxiety Disorders	Associate	23406438, 24756342, 27378548, 37023023, 37254074
Apparent mineralocorticoid excess	Associate	21042587
Arthritis Rheumatoid	Associate	19877072, 20727199, 22889053, 25724472
Asthma	Associate	15295049, 15635817, 16567656, 18396779, 21113676, 21917909, 22015776, 25411910, 25625944, 25748343, 25897650, 26635083, 30544846, 30736733, 30738043 View all (8 more)
Asthma	Inhibit	25488691
Atherosclerosis	Associate	26186654
Attention Deficit Disorder with Hyperactivity	Associate	27391809
Autoimmune Diseases	Associate	29643853
Bipolar Disorder	Associate	21881570, 22427805, 22812453, 24143878, 24345775, 28291257, 37761918, 38482990
Bipolar Disorder	Inhibit	25522387
Borderline Personality Disorder	Associate	22139575, 22832351, 25612291, 26080088, 33705478
Brain Diseases	Associate	35563330
Brain Injuries	Associate	39314520
Brain Injuries Traumatic	Associate	37418975
Brain Neoplasms	Associate	37878192
Breast Neoplasms	Associate	10751396, 12559052, 15590693, 18668364, 20018896, 23342266, 26424557, 27062924, 27141101, 28262792, 28832545, 29792595, 30103404, 30726932, 30987626 View all (11 more)
Breast Neoplasms	Inhibit	24622770
Breast Neoplasms	Stimulate	26825173, 29991529
Breast Neoplasms Male	Associate	29396493
Brenner Tumor	Associate	8878453
Bronchiolitis Obliterans Syndrome	Associate	29352737
Bronchopulmonary Dysplasia	Associate	25409741
Carcinogenesis	Associate	17167179, 31772120
Carcinoma Hepatocellular	Associate	30769091, 38604154
Carcinoma Non Small Cell Lung	Associate	24736075, 37691854, 37759686
Carcinoma Renal Cell	Associate	37807060
Carcinoma Squamous Cell	Associate	17392827, 29636077, 39756106
Cardiomyopathies	Associate	25338953
Cardiovascular Diseases	Associate	16849409, 27600822, 36012132
Carotid Intimal Medial Thickness 1	Associate	37023023
Cell Transformation Neoplastic	Associate	26374485
Central Serous Chorioretinopathy	Associate	28334414
Cerebral Hemorrhage	Associate	29651892
Cerebral Infarction	Associate	29651892
Cholangitis Sclerosing	Associate	15635817
Chronic Pain	Associate	30079801
Cognition Disorders	Associate	21544576, 33284958, 38482990
Cognitive Dysfunction	Stimulate	37107586
Colitis Ulcerative	Associate	15635817, 15793862, 34733451
Colonic Neoplasms	Associate	31375708
Colorectal Neoplasms	Associate	17167179, 24622770, 28902367, 31375708, 32533587, 32953885
Complement Component C1s Deficiency	Associate	28069032
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Associate	23028665
Congenital central hypoventilation syndrome	Associate	36538565
Coronary Artery Disease	Stimulate	23009206
Coronary Artery Disease	Associate	29473427
Coronary Disease	Associate	19783104, 25683698
Corticosteroid Binding Globulin Deficiency	Associate	26678267, 36139147
COVID 19	Associate	32983174, 36091061, 36114180, 36460583, 36720399
Critical Illness	Associate	37409973, 39314520
Crohn Disease	Associate	15996200, 19673019
Cryptogenic Organizing Pneumonia	Associate	31545224
Cushing Syndrome	Associate	10802524, 16855182, 24483153, 26873309, 34489873, 36233250
Cushing Syndrome	Stimulate	36555435
Cutaneous Fistula	Associate	26106668, 33373777
Cystic Fibrosis	Associate	18047640, 31664087
Cytokine Release Syndrome	Associate	23593222
Deafness	Associate	1350680
Death	Associate	27401254, 36537264
Depressive Disorder	Associate	19783104, 21544576, 23406438, 24135662, 26186654, 28179212, 29936334, 31438539, 32218512, 32699209, 33373777, 33762648, 34903727, 36091061, 36233250, 39778819 View all (1 more)
Depressive Disorder	Stimulate	29100173, 29556870
Depressive Disorder	Inhibit	32652588
Depressive Disorder Major	Associate	19540336, 20726698, 22832351, 23406438, 25765757, 26782558, 34903727, 36233250
Developmental Disabilities	Associate	29058930
Diabetes Gestational	Associate	23209187
Diabetes Mellitus	Associate	12805402, 22587831
Diabetes Mellitus	Inhibit	23212335
Diabetes Mellitus Type 2	Associate	27600822, 36233250, 38217051
Diabetic Nephropathies	Associate	35749380
Diabetic Nephropathies	Inhibit	36068241
Disease Resistance	Associate	21563193
Drug Hypersensitivity	Associate	28759007, 30020469, 36538565
Drug Related Side Effects and Adverse Reactions	Associate	10373553, 27557669, 29802709
Dry Eye Syndromes	Associate	20824100, 30963711
Dwarfism Pituitary	Associate	23567489
Dyslipidemias	Associate	25944971
Dyspepsia	Associate	28179212
Encephalitis St. Louis	Associate	26822442
Endometrial Neoplasms	Associate	29539426, 34813298, 8878453
Endometriosis	Associate	15011750, 22521153, 40124382
Epilepsy	Associate	30264400, 32748370, 34697589, 35563330
Epilepsy Post Traumatic	Associate	23548162
Epilepsy Temporal Lobe	Inhibit	32652588
Esophageal Squamous Cell Carcinoma	Associate	32106831
Essential Hypertension	Associate	12805402
Exocrine Pancreatic Insufficiency	Associate	39298385
Fatigue	Associate	16740143
Fatigue Syndrome Chronic	Associate	16740143, 19540336, 20941551, 24054763, 26272340
Fetal Growth Retardation	Associate	29796117
Fibrosarcoma	Associate	10597035, 12637494
Focal Cortical Dysplasia	Associate	35563330
Fragile X Syndrome	Associate	33373777
Frailty	Associate	21544576
Gastrointestinal Stromal Tumors	Associate	30103756
Glaucoma	Associate	18326728
Glaucoma Open Angle	Associate	20376328
Glioblastoma	Associate	34769089
Glioma	Associate	27560795, 31734653
Glomerulonephritis IGA	Associate	27730700, 34831409
Glomerulonephritis Membranous	Associate	34831409
Glomerulosclerosis Focal Segmental	Associate	27998979
Glucocorticoid Receptor Deficiency	Associate	16380507, 16855182, 20335448, 20861124, 21042587, 22260204, 22889053, 23512537, 24466047, 24483153, 24895125, 25938942, 26715915, 26745667, 27077774 View all (5 more)
Glucocorticoid Receptor Deficiency	Inhibit	32699209
Glucose Metabolism Disorders	Associate	22587831, 29802709
Graft vs Host Disease	Associate	25843653
Hamartoma Syndrome Multiple	Associate	27664120
Hearing Loss Sensorineural	Associate	28366034, 36782309
Heart Arrest	Associate	36691201
Heart Diseases	Associate	32218512
Hematologic Neoplasms	Associate	20354172, 23255118
Hemorrhage	Associate	18201403
Hepatitis Autoimmune	Associate	28374975
Hepatitis B	Associate	39297647
Hereditary Breast and Ovarian Cancer Syndrome	Associate	18239069
Hereditary leiomyomatosis and renal cell cancer	Associate	15467714, 16084893
Hidradenitis Suppurativa	Associate	39940809
HIV Infections	Associate	29936334, 34559394, 36044614, 36302121
Hyperandrogenism	Associate	11287026
Hypereosinophilic Syndrome	Associate	2612051
Hyperkinesis	Associate	34715840
Hyperlipidemia Familial Combined	Associate	23877856
Hyperlipoproteinemia Type II	Associate	16849409
Hypertension	Associate	12805402, 20335448, 21042587, 21544576, 23028665, 27649075, 30545316
Hypoglycemia	Associate	20335448
Hypokalemia	Associate	20335448, 21042587
Hypotension	Associate	29033349
Hypoxia	Associate	26825173, 36589842
Hypoxia	Stimulate	27560795
Ichthyosis X Linked	Associate	17947510, 19594946
Idiopathic Pulmonary Fibrosis	Associate	15282390, 35865549
Idiopathic Pulmonary Fibrosis	Inhibit	31545224
IgA Vasculitis	Associate	10701683
Immunoglobulin G4 Related Disease	Associate	29434340
Infections	Associate	23871663
Inflammation	Associate	15292225, 18047640, 18299991, 18396779, 19254810, 19564704, 21791059, 22295067, 22701743, 23687373, 23763497, 24703167, 25625944, 25683698, 26408078 View all (18 more)
Inflammation	Inhibit	21827450, 24424390, 27076634, 29529520, 30702561, 34893889, 35189144
Inflammatory Bowel Diseases	Associate	20712049, 39874239
Insulin Resistance	Associate	12351458
Intellectual Disability	Associate	38482990
Irritable Bowel Syndrome	Associate	27038676
Kidney Diseases	Associate	37477126
Kidney Neoplasms	Associate	29991691
Learning Disabilities	Associate	29796117
Left Right Axis Malformations	Associate	22832351, 27038676
Leiomyoma	Associate	22311344, 35426036
Lethargy	Associate	24135662, 26822442
Leukemia	Associate	16574952, 20170710, 20831260, 21224468, 25938942, 36490346, 7859735
Leukemia Biphenotypic Acute	Associate	34010787, 37217509, 39953147
Leukemia Lymphocytic Chronic B Cell	Associate	17699872
Leukemia T Cell	Associate	20156337
Leukoplakia Oral	Associate	37454941
Lipid Metabolism Disorders	Associate	37807060
Liver Cirrhosis Biliary	Associate	15635817
Lung Diseases	Associate	18047640, 24488492
Lung Diseases Interstitial	Stimulate	15282390
Lung Diseases Interstitial	Associate	31545224, 39756106
Lung Neoplasms	Associate	27484907, 28819152
Lupus Erythematosus Systemic	Associate	15212141, 19594946, 24151836, 39874239
Lymphoma	Associate	16461807, 29107989, 29738549
Lymphoma B Cell	Associate	23255118
Lymphoma Follicular	Associate	16461807
Lymphoma Large B Cell Diffuse	Stimulate	16461807
Lymphoma Large B Cell Diffuse	Associate	35069971, 37650932
Lymphoma Mantle Cell	Associate	16461807
Malformations of Cortical Development	Associate	32748370, 35563330
Malnutrition	Associate	21544576
Mandibulofacial Dysostosis	Associate	1676560
Melanoma	Associate	21455635
Mental Disorders	Associate	16855182, 21881570, 22427805, 26782558, 34903727, 36114180
Metabolic Diseases	Associate	35120172
Metabolic Syndrome	Associate	15919839, 16855182, 22587831, 22801563, 23028665, 23212335, 27600822, 33311027, 37761945
Mobility Limitation	Associate	16980656
Mood Disorders	Associate	24135662, 29556870, 33373777
Multiple Chronic Conditions	Associate	21544576
Multiple Myeloma	Associate	1728309, 18499442, 19133980, 22855579, 23255118, 25474406, 26715915, 31645658, 32228485, 32921213, 33284947, 34481515, 34600510, 9375757
Multiple Sclerosis	Inhibit	39201568
Muscular Dystrophies	Associate	28432191
Muscular Dystrophy Duchenne	Associate	16980656, 17937535, 33287327
Myocardial Infarction	Associate	24466047
Myostatin related muscle hypertrophy	Associate	28375666
Nasal Polyps	Associate	18396779, 32870597, 35690807
Neoplasm Metastasis	Associate	26825173, 30726932, 31375708, 39519365
Neoplasms	Associate	11836450, 15635817, 18239069, 18668364, 19117505, 19223869, 24736075, 26657081, 27060168, 27401254, 27635763, 28456378, 28797028, 28984199, 29396493 View all (20 more)
Neoplasms	Inhibit	21984896, 24622770, 25015855, 31675993, 35850708
Neoplasms	Stimulate	8669484
Neoplasms Adipose Tissue	Associate	15919839
Neoplasms Cystic Mucinous and Serous	Stimulate	28456378
Neoplasms Germ Cell and Embryonal	Associate	21793190
Neoplasms Neuroepithelial	Associate	9861846
Neoplasms Squamous Cell	Associate	17392827, 27060168, 33687433
Nephrotic Syndrome	Associate	24429396, 28751734, 34603785, 40055727
Nervous System Diseases	Associate	29796117
Neurobehavioral Manifestations	Associate	26585459, 26822442
Neuroblastoma	Associate	11080152, 35850708
Neurocognitive Disorders	Associate	38482990
Neuroendocrine Tumors	Associate	36640905
Neuroinflammatory Diseases	Associate	31861978
Neuroma Acoustic	Associate	29615643
Neuronal intranuclear inclusion disease	Associate	15977647
Neutrophil Immunodeficiency Syndrome	Associate	36949482
Nevus Sebaceous of Jadassohn	Associate	36640905
Non Muscle Invasive Bladder Neoplasms	Inhibit	25015855
Obesity	Associate	12805402, 15919839, 16210701, 16855182, 19564704, 20054173, 22587831, 22801563, 23028665, 23778418, 23784897, 23975165, 26821164, 28125591, 32849611, 36233250 View all (1 more)
Obesity	Inhibit	12917495
Obesity	Stimulate	23009206
Obesity Abdominal	Associate	10832763
Obesity Maternal	Associate	24135662, 33215541
Obesity Metabolically Benign	Associate	24535466
Ocular Hypertension	Associate	17563720, 25813999
Osteoarthritis	Associate	27716396
Osteoporosis	Associate	17002564, 17937535, 33494362
Osteosarcoma	Associate	21853138, 22174376, 23303127, 33494362
Otitis Media	Associate	33693626
Ovarian Diseases	Associate	33786734
Ovarian Neoplasms	Associate	12230951, 24629067, 28456378, 8878453
Ovarian Neoplasms	Inhibit	26935408
Overweight	Associate	12805402, 33762648
Pain	Associate	30079801, 34283174
Paine syndrome	Associate	34283174
Panic Disorder	Associate	37222222
Parkinson Disease	Associate	26516212
Pathophobia	Associate	33373777
Pediatric Obesity	Associate	22295073, 26080088, 26585459, 29796117, 39778819
Pemphigus	Associate	28928407
Perinatal Death	Associate	26518448
Personality Disorders	Associate	33762648
Phobia Social	Associate	34916236
Pituitary ACTH Hypersecretion	Associate	22570980, 23778418, 34489873, 35270010, 37065760, 9506748
Pituitary Neoplasms	Associate	34489873, 9506748
Polycystic Ovary Syndrome	Associate	11119758, 24626943, 38217051
Polycythemia	Associate	35861015
Polycythemia Vera	Associate	21355091, 22879541
Postoperative Cognitive Complications	Associate	36044614
Precancerous Conditions	Associate	37807060
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	35124168
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20156337, 20170710, 20354172, 20831260, 21084380, 22739263, 28179212, 39953147
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22739263, 35240234, 35734930
Pregnancy Complications	Associate	32218512
Pregnancy in Diabetics	Associate	34648084
Premature Birth	Associate	39298385
Primary cortisol resistance	Associate	21042587
Primary Myelofibrosis	Associate	21355091, 22879541
Primary Ovarian Insufficiency	Associate	8878453
Propping Zerres syndrome	Inhibit	25261097
Prostatic Neoplasms	Associate	17540466, 18097517, 26483423, 27340920, 28069826, 29436611, 30305646, 31727962, 31861264, 33303959, 33619826, 33795839, 35184651, 36452480, 37169162 View all (4 more)
Prostatic Neoplasms Castration Resistant	Associate	24882673, 31727962, 35184651
Prostatitis	Associate	22223138
Proteinuria	Associate	34831409
Psychogenic Nonepileptic Seizures	Associate	37593891
Psychological Distress	Associate	23406438, 30036796
Psychotic Disorders	Associate	24345775, 33284958
Pulmonary Disease Chronic Obstructive	Associate	20156759, 23704983, 24070494, 24368768, 25573300, 27769261, 29796117, 31022961, 35120172, 38641747, 9926163
Pulmonary Disease Chronic Obstructive	Inhibit	32021151, 35553638
Pulmonary edema of mountaineers	Associate	29587872, 30999951
Purpura Thrombocytopenic Idiopathic	Associate	27077774, 31905108, 33222560
Radiation Injuries	Associate	25961636
Reactive Attachment Disorder	Associate	29058930
Respiratory Sounds	Associate	30544846
Respiratory Syncytial Virus Infections	Inhibit	21190962
Respiratory Tract Diseases	Associate	39393618
Salivary Duct Calculi	Associate	31772120
Sarcoma	Associate	11836450
Sarcoma Kaposi	Associate	7887453, 8669484
Schizophrenia	Associate	21881570, 22427805, 22812453, 24345775, 33284958
Seizures	Associate	20335448, 32748370, 37593891
Severe Acute Respiratory Syndrome	Inhibit	25411910
Sexual Trauma	Associate	22832351
Signs and Symptoms	Associate	34715840
Sleep Apnea Obstructive	Inhibit	27050997
Sleep Deprivation	Associate	36748964
Sleep Initiation and Maintenance Disorders	Associate	16210701
Sleep Wake Disorders	Inhibit	32360438
Small Cell Lung Carcinoma	Associate	21984896, 34741430, 8163665
Small Cell Lung Carcinoma	Inhibit	29559689
Spondylodysplasia And Premature Pubarche	Associate	11287026, 20335448
Status Asthmaticus	Associate	15295049, 19254810, 19619331, 20543003, 22015776, 27501780, 8565317
Status Asthmaticus	Inhibit	17947510, 32849611, 34395637
Stomach Neoplasms	Associate	18158559, 33407483
Stress Disorders Post Traumatic	Associate	22832351, 25867994, 33762648
Substance Related Disorders	Associate	27378548, 34526487
Tachycardia Sinoatrial Nodal Reentry	Inhibit	25863981
Temporomandibular Joint Disorders	Associate	22074755
Tetra amelia with ectodermal dysplasia and lacrimal duct abnormalities	Associate	31697823
Thymoma	Associate	21437890
Thymus Neoplasms	Associate	21437890
Tinnitus	Associate	37222222
Triple Negative Breast Neoplasms	Associate	26374485, 26825173, 29620157, 29991529, 32816914, 39519365
Urinary Bladder Neoplasms	Inhibit	25015855
Urinary Bladder Neoplasms	Associate	27036026
Urologic Neoplasms	Associate	27635763
Uterine Cervical Neoplasms	Associate	26210472, 33494362
Vascular Malformations	Associate	30158362
Virilism	Associate	11119758
Vomiting	Associate	28030791
Weight Loss	Associate	21544576
Wolf Hirschhorn Syndrome	Associate	35124168
Wounds and Injuries	Associate	22832351, 23548162, 29158265, 33762648, 39314520
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	24029070

NR3C1 (nuclear receptor subfamily 3 group C member 1)