Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29079
Gene name Gene Name - the full gene name approved by the HGNC.
Mediator complex subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MED4
Synonyms (NCBI Gene) Gene synonyms aliases
ARC36, DRIP36, HSPC126, TRAP36, VDRIP
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q14.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016676 hsa-miR-425-5p Sequencing 20371350
MIRT021128 hsa-miR-186-5p Sequencing 20371350
MIRT023475 hsa-miR-23b-3p Sequencing 20371350
MIRT571407 hsa-miR-3133 PAR-CLIP 20371350
MIRT021128 hsa-miR-186-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003712 Function Transcription coregulator activity IBA
GO:0003712 Function Transcription coregulator activity IDA 10882111
GO:0003712 Function Transcription coregulator activity IEA
GO:0003713 Function Transcription coactivator activity IDA
GO:0003713 Function Transcription coactivator activity NAS 10235266
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605718 17903 ENSG00000136146
Protein
UniProt ID Q9NPJ6
Protein name Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36)
Protein function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN
PDB 7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 7NVR , 8GXQ , 8GXS , 8T9D , 8TQW , 8TRH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10018 Med4 63 206 Vitamin-D-receptor interacting Mediator subunit 4 Family
Sequence
MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAG
EENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQI
LATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDL
EMRSGLLGQMNNPSTNGVNGHLPGDA
LAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDF
LLEPPGHNKENEDDVEIMSTDSSSSSSESD
Sequence length 270
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Thyroid hormone signaling pathway   PPARA activates gene expression
Generic Transcription Pathway
Transcriptional regulation of white adipocyte differentiation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32533823
Carcinogenesis Associate 31695025
Carcinoma Non Small Cell Lung Associate 31638248
Constipation Associate 21505449
Heart Defects Congenital Associate 21505449
Lymphatic Metastasis Associate 31638248
Neoplasms Inhibit 31695025
Retinoblastoma Associate 21505449
Uterine Cervical Neoplasms Associate 19911042