GRIK4 (glutamate ionotropic receptor kainate type subunit 4)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2900
Gene name Gene Name - the full gene name approved by the HGNC.
Glutamate ionotropic receptor kainate type subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GRIK4
Synonyms (NCBI Gene) Gene synonyms aliases
EAA1, GRIK, GluK4, GluK4-2, KA1
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
SNP ID Visualize variation Clinical significance Consequence
rs1954787 T>C Benign, drug-response Intron variant, genic upstream transcript variant
rs869312699 CTGGCGCAGGAGGCC>GCT Likely-pathogenic Genic downstream transcript variant, coding sequence variant, inframe deletion
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(98)
miRTarBase ID miRNA Experiments Reference
MIRT017088 hsa-miR-335-5p Microarray 18185580
MIRT048273 hsa-miR-196a-5p CLASH 23622248
MIRT625181 hsa-miR-548b-3p HITS-CLIP 23824327
MIRT625180 hsa-miR-4511 HITS-CLIP 23824327
MIRT625179 hsa-miR-590-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IBA 21873635
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane TAS 8263508
GO:0007215 Process Glutamate receptor signaling pathway TAS 8263508
GO:0007268 Process Chemical synaptic transmission TAS 8263508
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600282 4582 ENSG00000149403
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q16099
Protein name Glutamate receptor ionotropic, kainate 4 (GluK4) (Excitatory amino acid receptor 1) (EAA1) (Glutamate receptor KA-1) (KA1)
Protein function Ionotropic glutamate receptor that functions as a cation-permeable ligand-gated ion channel. Cannot form functional channels on its own (PubMed:8263508). Shows channel activity only in heteromeric assembly with GRIK1, GRIK2 and GRIK3 subunits (B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01094 ANF_receptor 41 → 385 Receptor family ligand binding region Family
PF10613 Lig_chan-Glu_bd 416 → 530 Ligated ion channel L-glutamate- and glycine-binding site Domain
PF00060 Lig_chan 544 → 816 Ligand-gated ion channel Family
Sequence 
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSHLYASNISDTLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDSIHPRRRRAAVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
Sequence length 956
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Neuroactive ligand-receptor interaction
Glutamatergic synapse 		  Activation of Ca-permeable Kainate Receptor
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Autism Autistic behavior rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
Mental retardation Moderate intellectual disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 16325263, 23357115, 18289755, 17449450
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease 26634245 ClinVar
Mental depression Unipolar Depression, Major Depressive Disorder 22222462 ClinVar
Attention Deficit Hyperactivity Disorder Attention Deficit Hyperactivity Disorder GWAS
Coronary artery disease Coronary artery disease GWAS
Show/Hide Text Mining Associations (18)
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 24812308
Autism Spectrum Disorder Associate 22543975
Autistic Disorder Associate 31844109
Bipolar Disorder Associate 18824690
Cerebral Palsy Associate 34098570
Chromosome Aberrations Associate 18824690
Cognition Disorders Associate 32245654
Coronary Artery Disease Associate 24812308
Depressive Disorder Associate 32245654
Depressive Disorder Major Associate 32245654