Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
28999
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF15
Synonyms (NCBI Gene) Gene synonyms aliases
KKLF
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q21.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016690 hsa-miR-133b Other 19720047
MIRT016690 hsa-miR-133b Other 19720047
MIRT035579 hsa-miR-133a-3p Other 19720047
MIRT731939 hsa-miR-376a-3p Luciferase reporter assay, qRT-PCR, Western blot 27979415
MIRT731939 hsa-miR-376a-3p Luciferase reporter assay, qRT-PCR, Western blot 27979415
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000976 Function Transcription cis-regulatory region binding ISS
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 19767294
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606465 14536 ENSG00000163884
Protein
UniProt ID Q9UIH9
Protein name Krueppel-like factor 15 (Kidney-enriched krueppel-like factor)
Protein function Transcriptional regulator that binds to the GA element of the CLCNKA promoter. Binds to the KCNIP2 promoter and regulates KCNIP2 circadian expression in the heart (By similarity). Is a repressor of CCN2 expression, involved in the control of car
PDB 2ENT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 321 345 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 351 375 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 381 403 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in liver, skeletal muscle, and kidney. Expressed in cardiomyocytes. Expression is highly reduced in cardiac tissue of patients with non-ischemic cardiomyopathy and aortic aneurysm, and in glomerular disease. Not expres
Sequence
MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQAL
CSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHF
CLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKS
HLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPG
QAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGP
AGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGW
RFSRSDELSRHRRSH
SGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN
Sequence length 416
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 28083984
Breast Neoplasms Associate 27629257, 31640084
Breast Neoplasms Inhibit 36347994
Carcinogenesis Inhibit 36347994
Cardiomegaly Inhibit 28400202
Cardiomyopathies Associate 29956764
Cardiomyopathy Hypertrophic Associate 33757590
Colorectal Neoplasms Inhibit 38273088
Dyslipidemias Associate 27199507
Glioma Associate 33275234