Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	28999
Gene name Gene Name - the full gene name approved by the HGNC.	KLF transcription factor 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KLF15
Synonyms (NCBI Gene) Gene synonyms aliases	KKLF
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q21.3

Show/Hide all(62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016690	hsa-miR-133b	Other	19720047
MIRT016690	hsa-miR-133b	Other	19720047
MIRT035579	hsa-miR-133a-3p	Other	19720047
MIRT731939	hsa-miR-376a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27979415
MIRT731939	hsa-miR-376a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27979415
MIRT1096204	hsa-miR-1228	CLIP-seq
MIRT1096205	hsa-miR-128	CLIP-seq
MIRT1096206	hsa-miR-140-3p	CLIP-seq
MIRT1096207	hsa-miR-148a	CLIP-seq
MIRT1096208	hsa-miR-148b	CLIP-seq
MIRT1096209	hsa-miR-152	CLIP-seq
MIRT1096210	hsa-miR-1587	CLIP-seq
MIRT1096211	hsa-miR-1915	CLIP-seq
MIRT1096212	hsa-miR-342-3p	CLIP-seq
MIRT1096213	hsa-miR-3944-5p	CLIP-seq
MIRT1096214	hsa-miR-4417	CLIP-seq
MIRT1096215	hsa-miR-4490	CLIP-seq
MIRT1096216	hsa-miR-4492	CLIP-seq
MIRT1096217	hsa-miR-4498	CLIP-seq
MIRT1096218	hsa-miR-4656	CLIP-seq
MIRT1096219	hsa-miR-4675	CLIP-seq
MIRT1096220	hsa-miR-4726-3p	CLIP-seq
MIRT1096221	hsa-miR-4741	CLIP-seq
MIRT1096222	hsa-miR-541	CLIP-seq
MIRT1096223	hsa-miR-654-5p	CLIP-seq
MIRT1096224	hsa-miR-762	CLIP-seq
MIRT2025977	hsa-miR-1237	CLIP-seq
MIRT2025978	hsa-miR-1538	CLIP-seq
MIRT2025979	hsa-miR-1913	CLIP-seq
MIRT2025980	hsa-miR-324-3p	CLIP-seq
MIRT2025981	hsa-miR-4279	CLIP-seq
MIRT2025982	hsa-miR-4313	CLIP-seq
MIRT2025983	hsa-miR-4722-3p	CLIP-seq
MIRT2025984	hsa-miR-4745-3p	CLIP-seq
MIRT2257016	hsa-miR-103a	CLIP-seq
MIRT2257017	hsa-miR-107	CLIP-seq
MIRT2257018	hsa-miR-1184	CLIP-seq
MIRT2257019	hsa-miR-1226	CLIP-seq
MIRT1096205	hsa-miR-128	CLIP-seq
MIRT1096206	hsa-miR-140-3p	CLIP-seq
MIRT1096207	hsa-miR-148a	CLIP-seq
MIRT1096208	hsa-miR-148b	CLIP-seq
MIRT1096209	hsa-miR-152	CLIP-seq
MIRT2025979	hsa-miR-1913	CLIP-seq
MIRT2257020	hsa-miR-194	CLIP-seq
MIRT2257021	hsa-miR-2467-3p	CLIP-seq
MIRT2025980	hsa-miR-324-3p	CLIP-seq
MIRT1096213	hsa-miR-3944-5p	CLIP-seq
MIRT2025982	hsa-miR-4313	CLIP-seq
MIRT2257022	hsa-miR-4701-5p	CLIP-seq
MIRT2025983	hsa-miR-4722-3p	CLIP-seq
MIRT2257023	hsa-miR-4803	CLIP-seq
MIRT2257024	hsa-miR-588	CLIP-seq
MIRT2257025	hsa-miR-922	CLIP-seq
MIRT2389899	hsa-miR-4305	CLIP-seq
MIRT2389900	hsa-miR-4777-5p	CLIP-seq
MIRT2389901	hsa-miR-518d-5p	CLIP-seq
MIRT2389902	hsa-miR-519b-5p	CLIP-seq
MIRT2389903	hsa-miR-519c-5p	CLIP-seq
MIRT2389904	hsa-miR-520c-5p	CLIP-seq
MIRT2389905	hsa-miR-526a	CLIP-seq
MIRT2389906	hsa-miR-586	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19767294
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19767294
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	19767294
GO:0001678	Process	Cellular glucose homeostasis	IEA
GO:0005515	Function	Protein binding	IPI	23999430, 24722188, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	17438289
GO:0005654	Component	Nucleoplasm	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0010001	Process	Glial cell differentiation	IEA
GO:0014898	Process	Cardiac muscle hypertrophy in response to stress	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19767294
GO:0046326	Process	Positive regulation of glucose import	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0072112	Process	Glomerular visceral epithelial cell differentiation	ISS
GO:1901653	Process	Cellular response to peptide	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000757	Process	Negative regulation of peptidyl-lysine acetylation	IMP	20375365

MIM	HGNC	e!Ensembl
606465	14536	ENSG00000163884

Protein

UniProt ID

Q9UIH9

Protein name

Krueppel-like factor 15 (Kidney-enriched krueppel-like factor)

Protein function

Transcriptional regulator that binds to the GA element of the CLCNKA promoter. Binds to the KCNIP2 promoter and regulates KCNIP2 circadian expression in the heart (By similarity). Is a repressor of CCN2 expression, involved in the control of car

PDB

2ENT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	321 → 345	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	351 → 375	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	381 → 403	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, skeletal muscle, and kidney. Expressed in cardiomyocytes. Expression is highly reduced in cardiac tissue of patients with non-ischemic cardiomyopathy and aortic aneurysm, and in glomerular disease. Not expres

Sequence

MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQAL
CSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHF
CLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKS
HLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPG
QAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGP
AGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGW
RFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN

Sequence length

416

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Gout	Gout			GWAS

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	28083984
Breast Neoplasms	Associate	27629257, 31640084
Breast Neoplasms	Inhibit	36347994
Carcinogenesis	Inhibit	36347994
Cardiomegaly	Inhibit	28400202
Cardiomyopathies	Associate	29956764
Cardiomyopathy Hypertrophic	Associate	33757590
Colorectal Neoplasms	Inhibit	38273088
Dyslipidemias	Associate	27199507
Glioma	Associate	33275234
Glucose Metabolism Disorders	Associate	29956764
Heart Failure	Associate	28400202
Hypertrophy Left Ventricular	Associate	28400202, 37302544
Insulin Resistance	Associate	28570579
Kidney Diseases	Associate	29956764
Muscular Atrophy	Associate	33687156
Myoepithelioma	Associate	33734915, 36577525
Myostatin related muscle hypertrophy	Inhibit	28375666
Neoplasm Metastasis	Inhibit	36347994
Neoplasms	Inhibit	27629257, 36347994
Neoplasms	Associate	28083984, 36577525
Obesity	Associate	27199507, 28570579
Ovarian Neoplasms	Associate	32731816
Polycystic Ovary Syndrome	Associate	39585802
Post Acute COVID 19 Syndrome	Associate	37915075
Soft Tissue Neoplasms	Associate	33734915
Stomach Neoplasms	Associate	34727954
Triple Negative Breast Neoplasms	Associate	36347994
Uterine Cervical Neoplasms	Associate	25119587
Vascular Diseases	Associate	29956764
Ventricular Dysfunction Left	Associate	28400202

KLF15 (KLF transcription factor 15)