Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	28999
Gene name	KLF transcription factor 15
Gene symbol	KLF15
Synonyms (NCBI Gene)	KKLF
Chromosome	3
Chromosome location	3q21.3

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016690	hsa-miR-133b	Other	19720047
MIRT016690	hsa-miR-133b	Other	19720047
MIRT035579	hsa-miR-133a-3p	Other	19720047
MIRT731939	hsa-miR-376a-3p	Luciferase reporter assayqRT-PCRWestern blot	27979415
MIRT731939	hsa-miR-376a-3p	Luciferase reporter assayqRT-PCRWestern blot	27979415
MIRT1096204	hsa-miR-1228	CLIP-seq
MIRT1096205	hsa-miR-128	CLIP-seq
MIRT1096206	hsa-miR-140-3p	CLIP-seq
MIRT1096207	hsa-miR-148a	CLIP-seq
MIRT1096208	hsa-miR-148b	CLIP-seq
MIRT1096209	hsa-miR-152	CLIP-seq
MIRT1096210	hsa-miR-1587	CLIP-seq
MIRT1096211	hsa-miR-1915	CLIP-seq
MIRT1096212	hsa-miR-342-3p	CLIP-seq
MIRT1096213	hsa-miR-3944-5p	CLIP-seq
MIRT1096214	hsa-miR-4417	CLIP-seq
MIRT1096215	hsa-miR-4490	CLIP-seq
MIRT1096216	hsa-miR-4492	CLIP-seq
MIRT1096217	hsa-miR-4498	CLIP-seq
MIRT1096218	hsa-miR-4656	CLIP-seq
MIRT1096219	hsa-miR-4675	CLIP-seq
MIRT1096220	hsa-miR-4726-3p	CLIP-seq
MIRT1096221	hsa-miR-4741	CLIP-seq
MIRT1096222	hsa-miR-541	CLIP-seq
MIRT1096223	hsa-miR-654-5p	CLIP-seq
MIRT1096224	hsa-miR-762	CLIP-seq
MIRT2025977	hsa-miR-1237	CLIP-seq
MIRT2025978	hsa-miR-1538	CLIP-seq
MIRT2025979	hsa-miR-1913	CLIP-seq
MIRT2025980	hsa-miR-324-3p	CLIP-seq
MIRT2025981	hsa-miR-4279	CLIP-seq
MIRT2025982	hsa-miR-4313	CLIP-seq
MIRT2025983	hsa-miR-4722-3p	CLIP-seq
MIRT2025984	hsa-miR-4745-3p	CLIP-seq
MIRT2257016	hsa-miR-103a	CLIP-seq
MIRT2257017	hsa-miR-107	CLIP-seq
MIRT2257018	hsa-miR-1184	CLIP-seq
MIRT2257019	hsa-miR-1226	CLIP-seq
MIRT1096205	hsa-miR-128	CLIP-seq
MIRT1096206	hsa-miR-140-3p	CLIP-seq
MIRT1096207	hsa-miR-148a	CLIP-seq
MIRT1096208	hsa-miR-148b	CLIP-seq
MIRT1096209	hsa-miR-152	CLIP-seq
MIRT2025979	hsa-miR-1913	CLIP-seq
MIRT2257020	hsa-miR-194	CLIP-seq
MIRT2257021	hsa-miR-2467-3p	CLIP-seq
MIRT2025980	hsa-miR-324-3p	CLIP-seq
MIRT1096213	hsa-miR-3944-5p	CLIP-seq
MIRT2025982	hsa-miR-4313	CLIP-seq
MIRT2257022	hsa-miR-4701-5p	CLIP-seq
MIRT2025983	hsa-miR-4722-3p	CLIP-seq
MIRT2257023	hsa-miR-4803	CLIP-seq
MIRT2257024	hsa-miR-588	CLIP-seq
MIRT2257025	hsa-miR-922	CLIP-seq
MIRT2389899	hsa-miR-4305	CLIP-seq
MIRT2389900	hsa-miR-4777-5p	CLIP-seq
MIRT2389901	hsa-miR-518d-5p	CLIP-seq
MIRT2389902	hsa-miR-519b-5p	CLIP-seq
MIRT2389903	hsa-miR-519c-5p	CLIP-seq
MIRT2389904	hsa-miR-520c-5p	CLIP-seq
MIRT2389905	hsa-miR-526a	CLIP-seq
MIRT2389906	hsa-miR-586	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19767294
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19767294
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	19767294
GO:0001678	Process	Intracellular glucose homeostasis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	23999430, 24722188, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	17438289
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010001	Process	Glial cell differentiation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014898	Process	Cardiac muscle hypertrophy in response to stress	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19767294
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071635	Process	Negative regulation of transforming growth factor beta production	IEA
GO:0072112	Process	Podocyte differentiation	IEA
GO:0072112	Process	Podocyte differentiation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990859	Process	Cellular response to endothelin	IEA
GO:2000757	Process	Negative regulation of peptidyl-lysine acetylation	IMP	20375365

MIM	HGNC	e!Ensembl
606465	14536	ENSG00000163884

Q9UIH9

Protein name

Krueppel-like factor 15 (Kidney-enriched krueppel-like factor)

Protein function

Transcriptional regulator that binds to the GA element of the CLCNKA promoter. Binds to the KCNIP2 promoter and regulates KCNIP2 circadian expression in the heart (By similarity). Is a repressor of CCN2 expression, involved in the control of car

PDB

2ENT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	321 → 345	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	351 → 375	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	381 → 403	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, skeletal muscle, and kidney. Expressed in cardiomyocytes. Expression is highly reduced in cardiac tissue of patients with non-ischemic cardiomyopathy and aortic aneurysm, and in glomerular disease. Not expres

Sequence

MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQAL
CSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHF
CLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKS
HLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPG
QAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGP
AGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGW
RFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN

Sequence length

416

Interactions

View interactions

KLF15 (KLF transcription factor 15)