Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
28992
Gene name Gene Name - the full gene name approved by the HGNC.
Mono-ADP ribosylhydrolase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MACROD1
Synonyms (NCBI Gene) Gene synonyms aliases
LRP16
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023592 hsa-miR-1-3p Proteomics 18668040
MIRT1124998 hsa-miR-1273 CLIP-seq
MIRT1124999 hsa-miR-1910 CLIP-seq
MIRT1125000 hsa-miR-3154 CLIP-seq
MIRT1125001 hsa-miR-3179 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
RARA Repression 19698236
SP1 Activation 18206366
SPI1 Repression 19698236
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17914104, 20035625, 21483817, 28514442, 32296183, 33961781
GO:0005634 Component Nucleus IDA 23474712
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610400 29598 ENSG00000133315
Protein
UniProt ID Q9BQ69
Protein name ADP-ribose glycohydrolase MACROD1 (MACRO domain-containing protein 1) (O-acetyl-ADP-ribose deacetylase MACROD1) (EC 3.1.1.106) (Protein LRP16) ([Protein ADP-ribosylaspartate] hydrolase MACROD1) (EC 3.2.2.-) ([Protein ADP-ribosylglutamate] hydrolase MACROD
Protein function Removes ADP-ribose from aspartate and glutamate residues in proteins bearing a single ADP-ribose moiety (PubMed:23474712, PubMed:23474714). Inactive towards proteins bearing poly-ADP-ribose (PubMed:23474712, PubMed:23474714). Deacetylates O-acet
PDB 2X47 , 6LH4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01661 Macro 170 283 Macro domain Domain
Sequence
MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAG
VGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFV
RLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGG
GGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQA
AELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIV
LATLREWLEQHKDKVDR
LIICVFLEKDEDIYRSRLPHYFPVA
Sequence length 325
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 28745792
Carcinoma Ductal Breast Associate 20649898
Colorectal Neoplasms Associate 20355243
Inflammation Stimulate 30562745
Lymphatic Metastasis Associate 28745792
Neoplasm Metastasis Associate 20355243, 20649898, 28745792
Neoplasms Stimulate 20355243, 20649898
Neoplasms Associate 21483817
Neuroblastoma Associate 32427867
Stomach Neoplasms Associate 21483817