ASTE1 (asteroid structure-specific endonuclease 1)

Gene

• Entrez ID: 28990
• Gene name: Asteroid structure-specific endonuclease 1
• Gene symbol: ASTE1
• Synonyms (NCBI Gene): HT001
• Chromosome: 3
• Chromosome location: 3q22.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051406	hsa-let-7f-5p	CLASH	23622248
MIRT803243	hsa-miR-1293	CLIP-seq
MIRT803244	hsa-miR-191	CLIP-seq
MIRT803245	hsa-miR-3159	CLIP-seq
MIRT803246	hsa-miR-3673	CLIP-seq
MIRT803247	hsa-miR-4483	CLIP-seq
MIRT803248	hsa-miR-498	CLIP-seq
MIRT803249	hsa-miR-590-3p	CLIP-seq
MIRT803250	hsa-miR-890	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000014	Function	Single-stranded DNA endodeoxyribonuclease activity	IDA	34354233
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	34354233
GO:0004518	Function	Nuclease activity	IEA
GO:0004520	Function	DNA endonuclease activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 34354233
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IEA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IMP	34354233
GO:0006310	Process	DNA recombination	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:1990599	Function	3' overhang single-stranded DNA endodeoxyribonuclease activity	IDA	34354233

Other IDs

• MIM: 620693
• HGNC: 25021
• e!Ensembl: ENSG00000034533

Protein

• UniProt ID: Q2TB18
• Protein name: Single-strand DNA endonuclease ASTE1 (EC 3.1.-.-) (Protein asteroid homolog 1)
• Protein function: Structure-specific DNA endonuclease that specifically cleaves single-stranded DNA and 3' overhang DNA. Contributes to the control of DNA double-strand break repair choice by antagonizing BRCA1-dependent homologous recombination (HR) and promotin
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00752	XPG_N	1 → 102	XPG N-terminal domain	Family
  PF12813	XPG_I_2	115 → 307	XPG domain containing	Domain

• Sequence:

  MGIRGLMSFVEDHSNEFFTDLKLRDTKIVIDGYALFHRLCFSSNLDLRYGGDYDSFADVV
  QKFFESLFACNICPYVVLDGGCDISDKKLTTLKDRAREKIQMAHSLSVGGSGYVCPLLIR
  EVFIQVLIKLRVCFVQCFSEADRDIMTLANHWNCPVLSSDSDFCIFDLKTGFCPLNSFQW
  RNMNTIKGTQNYIPAKCFSLDAFCHHFSNMNKALLPLFAVLCGNDHVNLPIMETFLSKAR
  LPLGATSSKGRRHHRILGLLNWLSHFANPTEALDNVLKYLPKKDRENVKELLCCSMEEYQ
  QSQVKLQDFFQCGTYVCPDALNLGLPEWVLVALAKGQLSPFISDALVLRRTILPTQVENM
  QQPNAHRISQPIRQIIYGLLLNASPHLDKTSWNALPPQPLAFSEVERINKNIRTSIIDAV
  ELAKDHSDLSRLTELSLRRRQMLLLETLKVKQTILEPIPTSLKLPIAVSCYWLQHTETKA
  KLHHLQSLLLTMLVGPLIAIINSPGKEELQEDGAKMLYAEFQRVKAQTRLGTRLDLDTAH
  IFCQWQSCLQMGMYLNQLLSTPLPEPDLTRLYSGSLVHGLCQQLLASTSVESLLSICPEA
  KQLYEYLFNATRSYAPAEIFLPKGRSNSKKKRQKKQNTSCSKNRGRTTAHTKCWYEGNNR
  FGLLMVENLEEHSEASNIE

• Sequence length: 679

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTE1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYNCH SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MISMATCH REPAIR CANCER SYNDROME 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Colorectal Neoplasms	Associate	19503063	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19503063	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Associate	25816162	★☆☆☆☆ Found in Text Mining only