Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	28988
Gene name Gene Name - the full gene name approved by the HGNC.	Drebrin like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DBNL
Synonyms (NCBI Gene) Gene synonyms aliases	ABP1, HIP-55, HIP55, SH3P7
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p13

Show/Hide all(67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022629	hsa-miR-124-3p	Microarray	18668037
MIRT025775	hsa-miR-7-5p	Microarray	19073608
MIRT028810	hsa-miR-26b-5p	Microarray	19088304
MIRT051893	hsa-let-7b-5p	CLASH	23622248
MIRT046641	hsa-miR-222-3p	CLASH	23622248
MIRT041370	hsa-miR-193b-3p	CLASH	23622248
MIRT052809	hsa-miR-3187-3p	CLASH	23622248
MIRT924051	hsa-miR-103b	CLIP-seq
MIRT924052	hsa-miR-1255a	CLIP-seq
MIRT924053	hsa-miR-1255b	CLIP-seq
MIRT924054	hsa-miR-1302	CLIP-seq
MIRT924055	hsa-miR-1972	CLIP-seq
MIRT924056	hsa-miR-2116	CLIP-seq
MIRT924057	hsa-miR-2467-3p	CLIP-seq
MIRT924058	hsa-miR-3126-5p	CLIP-seq
MIRT924059	hsa-miR-3160-3p	CLIP-seq
MIRT924060	hsa-miR-3170	CLIP-seq
MIRT924061	hsa-miR-324-5p	CLIP-seq
MIRT924062	hsa-miR-342-5p	CLIP-seq
MIRT924063	hsa-miR-346	CLIP-seq
MIRT924064	hsa-miR-3651	CLIP-seq
MIRT924065	hsa-miR-3919	CLIP-seq
MIRT924066	hsa-miR-3922-5p	CLIP-seq
MIRT924067	hsa-miR-3929	CLIP-seq
MIRT924068	hsa-miR-4260	CLIP-seq
MIRT924069	hsa-miR-4271	CLIP-seq
MIRT924070	hsa-miR-4286	CLIP-seq
MIRT924071	hsa-miR-4298	CLIP-seq
MIRT924072	hsa-miR-4419b	CLIP-seq
MIRT924073	hsa-miR-4438	CLIP-seq
MIRT924074	hsa-miR-4462	CLIP-seq
MIRT924075	hsa-miR-4478	CLIP-seq
MIRT924076	hsa-miR-4487	CLIP-seq
MIRT924077	hsa-miR-4514	CLIP-seq
MIRT924078	hsa-miR-4529-5p	CLIP-seq
MIRT924079	hsa-miR-4645-5p	CLIP-seq
MIRT924080	hsa-miR-4651	CLIP-seq
MIRT924081	hsa-miR-4664-5p	CLIP-seq
MIRT924082	hsa-miR-4673	CLIP-seq
MIRT924083	hsa-miR-4677-5p	CLIP-seq
MIRT924084	hsa-miR-4692	CLIP-seq
MIRT924085	hsa-miR-4717-5p	CLIP-seq
MIRT924086	hsa-miR-4725-3p	CLIP-seq
MIRT924087	hsa-miR-4727-5p	CLIP-seq
MIRT924088	hsa-miR-4753-5p	CLIP-seq
MIRT924089	hsa-miR-4756-3p	CLIP-seq
MIRT924090	hsa-miR-4769-3p	CLIP-seq
MIRT924091	hsa-miR-542-3p	CLIP-seq
MIRT924092	hsa-miR-556-5p	CLIP-seq
MIRT924093	hsa-miR-558	CLIP-seq
MIRT924094	hsa-miR-608	CLIP-seq
MIRT924095	hsa-miR-627	CLIP-seq
MIRT924096	hsa-miR-7	CLIP-seq
MIRT924097	hsa-miR-924	CLIP-seq
MIRT924098	hsa-miR-31	CLIP-seq
MIRT924099	hsa-miR-335	CLIP-seq
MIRT924100	hsa-miR-4421	CLIP-seq
MIRT924101	hsa-miR-4688	CLIP-seq
MIRT1973695	hsa-miR-1912	CLIP-seq
MIRT1973696	hsa-miR-1915	CLIP-seq
MIRT1973697	hsa-miR-3130-5p	CLIP-seq
MIRT1973698	hsa-miR-4482	CLIP-seq
MIRT2209211	hsa-miR-3158-3p	CLIP-seq
MIRT2209212	hsa-miR-4435	CLIP-seq
MIRT2209213	hsa-miR-4701-5p	CLIP-seq
MIRT2209214	hsa-miR-548s	CLIP-seq
MIRT2209215	hsa-miR-588	CLIP-seq

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001726	Component	Ruffle	ISS
GO:0002102	Component	Podosome	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005515	Function	Protein binding	IPI	16189514, 17306257, 19060904, 21044950, 25416956, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	ISS
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005884	Component	Actin filament	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005938	Component	Cell cortex	ISS
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0007257	Process	Activation of JUN kinase activity	TAS	10567356
GO:0007416	Process	Synapse assembly	ISS
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0008047	Function	Enzyme activator activity	TAS	10567356
GO:0014069	Component	Postsynaptic density	IBA	21873635
GO:0016601	Process	Rac protein signal transduction	ISS
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030027	Component	Lamellipodium	IBA	21873635
GO:0030027	Component	Lamellipodium	ISS
GO:0030425	Component	Dendrite	IBA	21873635
GO:0030427	Component	Site of polarized growth	IBA	21873635
GO:0030665	Component	Clathrin-coated vesicle membrane	IEA
GO:0030833	Process	Regulation of actin filament polymerization	IBA	21873635
GO:0030864	Component	Cortical actin cytoskeleton	IBA	21873635
GO:0034774	Component	Secretory granule lumen	TAS
GO:0043204	Component	Perikaryon	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045211	Component	Postsynaptic membrane	IBA	21873635
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045773	Process	Positive regulation of axon extension	IBA	21873635
GO:0048812	Process	Neuron projection morphogenesis	IBA	21873635
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0051015	Function	Actin filament binding	IBA	21873635
GO:0051015	Function	Actin filament binding	ISS
GO:0061003	Process	Positive regulation of dendritic spine morphogenesis	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071800	Process	Podosome assembly	ISS
GO:0097178	Process	Ruffle assembly	IEA
GO:0098974	Process	Postsynaptic actin cytoskeleton organization	IBA	21873635
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
610106	2696	ENSG00000136279

Protein

UniProt ID

Q9UJU6

Protein name

Drebrin-like protein (Cervical SH3P7) (Cervical mucin-associated protein) (Drebrin-F) (HPK1-interacting protein of 55 kDa) (HIP-55) (SH3 domain-containing protein 7)

Protein function

Adapter protein that binds F-actin and DNM1, and thereby plays a role in receptor-mediated endocytosis. Plays a role in the reorganization of the actin cytoskeleton, formation of cell projections, such as neurites, in neuron morphogenesis and sy

PDB

1X67

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00241	Cofilin_ADF	12 → 131	Cofilin/tropomyosin-type actin-binding protein	Domain
PF14604	SH3_9	378 → 427	Variant SH3 domain	Domain

Sequence

MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSG
KVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAE
EDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFW
AKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQEQGGEASPQRTWEQQ
QEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
PAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQQQGAGSEHI
DHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGM
FPANYVELIE

Sequence length

430

Interactions

View interactions

	Reactome
			Caspase-mediated cleavage of cytoskeletal proteins Neurexins and neuroligins Neutrophil degranulation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Glycogen storage disease	Glycogen storage disease type X	rs10250779, rs387906244, rs113994126, rs113994129, rs113994134, rs369973784, rs199922945, rs118203964, rs113994132, rs387906246, rs113994128, rs267606639, rs267606640, rs755419857, rs895690691 View all (721 more)	27612597, 8447317

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Aortic Dissection	Associate	39738466
Bipolar Disorder	Associate	22760556, 35821008
Common Variable Immunodeficiency	Associate	36220400
Leukemia Promyelocytic Acute	Associate	15637062
Rosacea	Associate	37437773

DBNL (drebrin like)