Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
28972
Gene name Gene Name - the full gene name approved by the HGNC.
Signal peptidase complex subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPCS1
Synonyms (NCBI Gene) Gene synonyms aliases
HSPC033, SPC1, SPC12, YJR010C-A
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020721 hsa-miR-155-5p Proteomics 18668040
MIRT641713 hsa-miR-106a-5p HITS-CLIP 23824327
MIRT641712 hsa-miR-106b-5p HITS-CLIP 23824327
MIRT641711 hsa-miR-17-5p HITS-CLIP 23824327
MIRT641710 hsa-miR-20a-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24009510, 29593046, 34388369
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005787 Component Signal peptidase complex IBA
GO:0005787 Component Signal peptidase complex IEA
GO:0005787 Component Signal peptidase complex IPI 34388369
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610358 23401 ENSG00000114902
Protein
UniProt ID Q9Y6A9
Protein name Signal peptidase complex subunit 1 (Microsomal signal peptidase 12 kDa subunit) (SPase 12 kDa subunit)
Protein function Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (PubMed:34388369). Dispensable for SPC enzymat
PDB 7P2P , 7P2Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06645 SPC12 12 82 Microsomal signal peptidase 12 kDa subunit (SPC12) Family
Sequence
MARGGDTGCTGPSETSASGAAAIALPGLEGPATDAQCQTLPLTVLKSRSPSPRSLPPALS
CPPPQPAMLEHLSSLPTQMDYK
GQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVM
AGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN
Sequence length 169
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Protein export   Synthesis, secretion, and deacylation of Ghrelin
<