Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	28965
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 27 member 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC27A6
Synonyms (NCBI Gene) Gene synonyms aliases	ACSVL2, FACVL2, FATP6, VLCS-H1
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been fou

Show/Hide all(10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017231	hsa-miR-335-5p	Microarray	18185580
MIRT029105	hsa-miR-26b-5p	Microarray	19088304
MIRT1358077	hsa-miR-4282	CLIP-seq
MIRT1358078	hsa-miR-4477a	CLIP-seq
MIRT1358079	hsa-miR-4477b	CLIP-seq
MIRT1358080	hsa-miR-4668-3p	CLIP-seq
MIRT1358081	hsa-miR-4795-3p	CLIP-seq
MIRT1358082	hsa-miR-491-3p	CLIP-seq
MIRT1358083	hsa-miR-501-3p	CLIP-seq
MIRT1358084	hsa-miR-502-3p	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000038	Process	Very long-chain fatty acid metabolic process	TAS	10471116
GO:0000166	Function	Nucleotide binding	IEA
GO:0001676	Process	Long-chain fatty acid metabolic process	IBA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IBA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IEA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	TAS	10471116
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0015245	Function	Fatty acid transmembrane transporter activity	IEA
GO:0015245	Function	Fatty acid transmembrane transporter activity	TAS
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0015909	Process	Long-chain fatty acid transport	TAS
GO:0016020	Component	Membrane	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0044539	Process	Long-chain fatty acid import into cell	IBA
GO:0047676	Function	Arachidonate-CoA ligase activity	IEA

MIM	HGNC	e!Ensembl
604196	11000	ENSG00000113396

Protein

UniProt ID

Q9Y2P4

Protein name

Long-chain fatty acid transport protein 6 (FATP-6) (Fatty acid transport protein 6) (Arachidonate--CoA ligase) (EC 6.2.1.15) (Fatty-acid-coenzyme A ligase, very long-chain 2) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Solute carrier family 27 membe

Protein function

Mediates the import of long-chain fatty acids (LCFA) into the cell by facilitating their transport at the plasma membrane (PubMed:12556534). Also functions as an acyl-CoA ligase catalyzing the ATP-dependent formation of fatty acyl-CoA using LCFA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00501	AMP-binding	60 → 487	AMP-binding enzyme	Family
PF13193	AMP-binding_C	495 → 571	AMP-binding enzyme C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in heart and localizes to cardiac myocytes (PubMed:12556534). Expressed at moderate levels in placenta, testis, and adrenal glands. Expressed at very low levels in kidney, bladder and uterus. {ECO:0000269|PubMed:1255

Sequence

MLLSWLTVLGAGMVVLHFLQKLLFPYFWDDFWFVLKVVLIIIRLKKYEKRGELVTVLDKF
LSHAKRQPRKPFIIYEGDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFVH
VWFGLAKLGCVVAFLNTNIRSNSLLNCIRACGPRALVVGADLLGTVEEILPSLSENISVW
GMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQ
VLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWSDC
KKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLDRFGNIKVCEL
YAATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGE
PGLLISRVNAKNPFFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRT
GDTFRWKGENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEK
VYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKS
YVLLTRELYDQIMLGEIKL

Sequence length

619

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Insulin resistance		Transport of fatty acids

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Anemia	Severe aplastic anemia	N/A	N/A	GWAS
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Heart Failure	Heart failure	N/A	N/A	GWAS
Hypertension	High blood pressure / hypertension, Hypertension (PheCode 401), Essential hypertension (PheCode 401.1)	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Inhibit	30911270
Colorectal Neoplasms	Associate	33078631
Death Sudden Cardiac	Associate	22661490
Diabetes Gestational	Inhibit	24262292
Diabetes Mellitus Type 2	Stimulate	33989714
Esophageal Squamous Cell Carcinoma	Associate	26004606
Heart Diseases	Associate	12556534
Mitral Valve Insufficiency	Associate	27250500
Obesity Maternal	Inhibit	24262292

SLC27A6 (solute carrier family 27 member 6)