Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	28957
Gene name	Mitochondrial ribosomal protein S28
Gene symbol	MRPS28
Synonyms (NCBI Gene)	COXPD47HSPC007MRP-S28MRP-S35MRPS35
Chromosome	8
Chromosome location	8q21.13
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028763	hsa-miR-26b-5p	Microarray	19088304
MIRT2275140	hsa-miR-1298	CLIP-seq
MIRT2275141	hsa-miR-4291	CLIP-seq
MIRT2275142	hsa-miR-4705	CLIP-seq
MIRT2275143	hsa-miR-4729	CLIP-seq
MIRT2275144	hsa-miR-545	CLIP-seq
MIRT2275145	hsa-miR-617	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005763	Component	Mitochondrial small ribosomal subunit	IBA
GO:0005763	Component	Mitochondrial small ribosomal subunit	NAS	25838379
GO:0005763	Component	Mitochondrial small ribosomal subunit	TAS	10938081
GO:0005840	Component	Ribosome	IEA
GO:0032543	Process	Mitochondrial translation	IMP	30566640
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
611990	14513	ENSG00000147586

Q9Y2Q9

Protein name

Small ribosomal subunit protein bS1m (28S ribosomal protein S28, mitochondrial) (MRP-S28) (S28mt) (28S ribosomal protein S35, mitochondrial) (MRP-S35) (S35mt)

PDB

3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10246	MRP-S35	74 → 178	Mitochondrial ribosomal protein MRP-S35	Family

Sequence

MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHS
ELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKF
HCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRS
KEEHHEK

Sequence length

187

Interactions

View interactions

	Reactome
			Mitochondrial translation elongation Mitochondrial translation termination

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Combined oxidative phosphorylation deficiency 47	Pathogenic	rs1808705345	RCV001250730

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
MRPS28-related disorder	Likely benign; Benign	rs186500857, rs148845662, rs115541997, rs201384563, rs16919579	RCV003913936 RCV003944580 RCV003919391 RCV003939347 RCV003922034

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma Follicular	Associate	23569218
Carcinogenesis	Associate	23569218

MRPS28 (mitochondrial ribosomal protein S28)