Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2891
Gene name Gene Name - the full gene name approved by the HGNC.
Glutamate ionotropic receptor AMPA type subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GRIA2
Synonyms (NCBI Gene) Gene synonyms aliases
GLUR2, GLURB, GluA2, GluR-K2, HBGR2, NEDLIB, gluR-2, gluR-B
Disease Acronyms (UniProt) Disease acronyms from UniProt database
NEDLIB
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to a family of glutamate receptors that are sensitive to al
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1579377564 G>T Likely-pathogenic Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003035 hsa-miR-181b-5p Luciferase assay/RT-PCR 18184693
MIRT003035 hsa-miR-181b-5p Luciferase reporter assay 18184693
MIRT003035 hsa-miR-181b-5p Reporter assay;Other 18184693
MIRT437343 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR 23595422
MIRT437343 hsa-miR-124-3p Luciferase reporter assay 27013590
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding ISS
GO:0001540 Function Amyloid-beta binding NAS 20032460
GO:0004970 Function Ionotropic glutamate receptor activity IDA 20614889
GO:0004971 Function AMPA glutamate receptor activity IBA 21873635
GO:0004971 Function AMPA glutamate receptor activity ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
138247 4572 ENSG00000120251
Protein
UniProt ID P42262
Protein name Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2)
Protein function Ionotropic glutamate receptor that functions as a ligand-gated cation channel, gated by L-glutamate and glutamatergic agonists such as alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA), quisqualic acid, and kainic acid (PubMed:2061
PDB 2WJW , 2WJX , 2XHD , 3R7X , 3RN8 , 3RNN , 3UA8 , 5H8S , 5YBF , 5YBG , 5ZG0 , 5ZG1 , 5ZG2 , 5ZG3 , 7F3O , 8I0B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01094 ANF_receptor 42 382 Receptor family ligand binding region Family
PF10613 Lig_chan-Glu_bd 414 529 Ligated ion channel L-glutamate- and glycine-binding site Domain
PF00060 Lig_chan 543 824 Ligand-gated ion channel Family
Sequence
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNG
PRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQ
KSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGL
GLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Sequence length 883
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Long-term depression
Amyotrophic lateral sclerosis
Huntington disease
Spinocerebellar ataxia
Pathways of neurodegeneration - multiple diseases
Cocaine addiction
Amphetamine addiction
Nicotine addiction
  Activation of AMPA receptors
Trafficking of GluR2-containing AMPA receptors
Unblocking of NMDA receptors, glutamate binding and activation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
31300657
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
18184693, 18163426
Seizure Tonic - clonic seizures rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061
View all (179 more)
31300657
Unknown
Disease term Disease name Evidence References Source
Mental depression Unipolar Depression, Major Depressive Disorder 23613500, 22057216 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 22417861
Alzheimer Disease Stimulate 19295912
Alzheimer Disease Associate 33401309, 34269494
Amyotrophic Lateral Sclerosis Associate 12694394
Autism Spectrum Disorder Associate 31300657, 35134694, 36161652, 36329391
Autistic Disorder Associate 36329391
Bipolar Disorder Associate 19448189
Brain Injuries Associate 16680761
Craniopharyngioma Inhibit 36123899
Developmental Disabilities Associate 31300657, 36161652