Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2888
Gene name	Growth factor receptor bound protein 14
Gene symbol	GRB14
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q24.3
Summary	The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin re

Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030152	hsa-miR-26b-5p	Microarray	19088304
MIRT2006489	hsa-miR-129-5p	CLIP-seq
MIRT2006490	hsa-miR-181a	CLIP-seq
MIRT2006491	hsa-miR-181b	CLIP-seq
MIRT2006492	hsa-miR-181c	CLIP-seq
MIRT2006493	hsa-miR-181d	CLIP-seq
MIRT2006494	hsa-miR-409-3p	CLIP-seq
MIRT2006495	hsa-miR-4262	CLIP-seq
MIRT2006496	hsa-miR-4307	CLIP-seq
MIRT2006489	hsa-miR-129-5p	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11278563
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11278563
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8647858
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	16246733
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IBA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IMP	16246733
GO:0060090	Function	Molecular adaptor activity	EXP	14623073

MIM	HGNC	e!Ensembl
601524	4565	ENSG00000115290

Q14449

Protein name

Growth factor receptor-bound protein 14 (GRB14 adapter protein)

Protein function

Adapter protein which modulates coupling of cell surface receptor kinases with specific signaling pathways. Binds to, and suppresses signals from, the activated insulin receptor (INSR). Potent inhibitor of insulin-stimulated MAPK3 phosphorylatio

PDB

2AUG , 2AUH , 4K81

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00788	RA	106 → 192	Ras association (RalGDS/AF-6) domain	Domain
PF00169	PH	235 → 342	PH domain	Domain
PF08947	BPS	369 → 416	BPS (Between PH and SH2)	Domain
PF00017	SH2	439 → 520	SH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in the liver, kidney, pancreas, testis, ovary, heart and skeletal muscle.

Sequence

MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGC
AADRRKKKDLDVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSR
ALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIE
EENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGF
LHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGA
PTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGC
SSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSP
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMS
HGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL

Sequence length

540

Interactions

View interactions

	Reactome
			Tie2 Signaling

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Uncertain significance	rs138756758	RCV005927246

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Autism Spectrum Disorder	Associate	30071822
Cardiovascular Diseases	Associate	31739742
Diabetes Mellitus	Associate	27281273
Diabetes Mellitus Type 2	Associate	21874001, 24455749, 25928419, 26395551, 31739742, 38202781
Diabetes Mellitus Type 2	Inhibit	30352878
Endometriosis	Associate	25296917
Hypertension	Associate	22479346
Insulin Resistance	Associate	30089489, 38202781
Lipedema	Associate	36385154
Obesity	Associate	24455749, 25928419, 35955692, 39408369
Obesity	Stimulate	30021629
Simpson Golabi Behmel syndrome	Associate	31739742
Tourette Syndrome	Associate	30071822

GRB14 (growth factor receptor bound protein 14)