GRB14 (growth factor receptor bound protein 14)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2888
Gene name Gene Name - the full gene name approved by the HGNC.
Growth factor receptor bound protein 14
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GRB14
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin re
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT030152 hsa-miR-26b-5p Microarray 19088304
MIRT2006489 hsa-miR-129-5p CLIP-seq
MIRT2006490 hsa-miR-181a CLIP-seq
MIRT2006491 hsa-miR-181b CLIP-seq
MIRT2006492 hsa-miR-181c CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 11278563
GO:0005737 Component Cytoplasm IEA
GO:0005768 Component Endosome IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601524 4565 ENSG00000115290
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q14449
Protein name Growth factor receptor-bound protein 14 (GRB14 adapter protein)
Protein function Adapter protein which modulates coupling of cell surface receptor kinases with specific signaling pathways. Binds to, and suppresses signals from, the activated insulin receptor (INSR). Potent inhibitor of insulin-stimulated MAPK3 phosphorylatio
PDB 2AUG , 2AUH , 4K81
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00788 RA 106 → 192 Ras association (RalGDS/AF-6) domain Domain
PF00169 PH 235 → 342 PH domain Domain
PF08947 BPS 369 → 416 BPS (Between PH and SH2) Domain
PF00017 SH2 439 → 520 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in the liver, kidney, pancreas, testis, ovary, heart and skeletal muscle.
Sequence 
MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGC
AADRRKKKDLDVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSR
ALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIE
EENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGF
LHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGA
PTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGC
SSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSP
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMS
HGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL
Sequence length 540
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Tie2 Signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Show/Hide Text Mining Associations (13)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 30071822
Cardiovascular Diseases Associate 31739742
Diabetes Mellitus Associate 27281273
Diabetes Mellitus Type 2 Associate 21874001, 24455749, 25928419, 26395551, 31739742, 38202781
Diabetes Mellitus Type 2 Inhibit 30352878
Endometriosis Associate 25296917
Hypertension Associate 22479346
Insulin Resistance Associate 30089489, 38202781
Lipedema Associate 36385154
Obesity Associate 24455749, 25928419, 35955692, 39408369