Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2886
Gene name Gene Name - the full gene name approved by the HGNC.	Growth factor receptor bound protein 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GRB7
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q12
Summary Summary of gene provided in NCBI Entrez Gene.	The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal

Show/Hide all(126)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016993	hsa-miR-335-5p	Microarray	18185580
MIRT028909	hsa-miR-26b-5p	Microarray	19088304
MIRT1033299	hsa-miR-1193	CLIP-seq
MIRT1033300	hsa-miR-1243	CLIP-seq
MIRT1033301	hsa-miR-1293	CLIP-seq
MIRT1033302	hsa-miR-1321	CLIP-seq
MIRT1033303	hsa-miR-3126-5p	CLIP-seq
MIRT1033304	hsa-miR-3180	CLIP-seq
MIRT1033305	hsa-miR-3180-3p	CLIP-seq
MIRT1033306	hsa-miR-3184	CLIP-seq
MIRT1033307	hsa-miR-3196	CLIP-seq
MIRT1033308	hsa-miR-3200-5p	CLIP-seq
MIRT1033309	hsa-miR-3612	CLIP-seq
MIRT1033310	hsa-miR-3960	CLIP-seq
MIRT1033311	hsa-miR-423-5p	CLIP-seq
MIRT1033312	hsa-miR-4419a	CLIP-seq
MIRT1033313	hsa-miR-4467	CLIP-seq
MIRT1033314	hsa-miR-4483	CLIP-seq
MIRT1033315	hsa-miR-4510	CLIP-seq
MIRT1033316	hsa-miR-4649-3p	CLIP-seq
MIRT1033317	hsa-miR-4739	CLIP-seq
MIRT1033318	hsa-miR-4756-5p	CLIP-seq
MIRT1033319	hsa-miR-650	CLIP-seq
MIRT1033320	hsa-miR-122	CLIP-seq
MIRT1033321	hsa-miR-1269	CLIP-seq
MIRT1033322	hsa-miR-1269b	CLIP-seq
MIRT1033323	hsa-miR-1288	CLIP-seq
MIRT1033324	hsa-miR-4433	CLIP-seq
MIRT1033325	hsa-miR-4447	CLIP-seq
MIRT1033326	hsa-miR-4459	CLIP-seq
MIRT1033327	hsa-miR-4472	CLIP-seq
MIRT1033328	hsa-miR-4481	CLIP-seq
MIRT1033329	hsa-miR-4488	CLIP-seq
MIRT1033330	hsa-miR-4515	CLIP-seq
MIRT1033331	hsa-miR-4697-5p	CLIP-seq
MIRT1033332	hsa-miR-4740-5p	CLIP-seq
MIRT1033333	hsa-miR-4745-5p	CLIP-seq
MIRT1033334	hsa-miR-4768-3p	CLIP-seq
MIRT1033299	hsa-miR-1193	CLIP-seq
MIRT1033300	hsa-miR-1243	CLIP-seq
MIRT1033320	hsa-miR-122	CLIP-seq
MIRT2238945	hsa-miR-1224-5p	CLIP-seq
MIRT2238946	hsa-miR-1268	CLIP-seq
MIRT2238947	hsa-miR-1268b	CLIP-seq
MIRT1033321	hsa-miR-1269	CLIP-seq
MIRT1033322	hsa-miR-1269b	CLIP-seq
MIRT1033323	hsa-miR-1288	CLIP-seq
MIRT2238948	hsa-miR-1827	CLIP-seq
MIRT2238949	hsa-miR-193a-3p	CLIP-seq
MIRT2238950	hsa-miR-193b	CLIP-seq
MIRT2238951	hsa-miR-204	CLIP-seq
MIRT2238952	hsa-miR-211	CLIP-seq
MIRT2238953	hsa-miR-2278	CLIP-seq
MIRT2238954	hsa-miR-3150b-3p	CLIP-seq
MIRT2238955	hsa-miR-3151	CLIP-seq
MIRT2238956	hsa-miR-3163	CLIP-seq
MIRT2238957	hsa-miR-3176	CLIP-seq
MIRT1033304	hsa-miR-3180	CLIP-seq
MIRT1033305	hsa-miR-3180-3p	CLIP-seq
MIRT1033307	hsa-miR-3196	CLIP-seq
MIRT2238958	hsa-miR-3615	CLIP-seq
MIRT2238959	hsa-miR-3915	CLIP-seq
MIRT2238960	hsa-miR-3922-3p	CLIP-seq
MIRT2238961	hsa-miR-3923	CLIP-seq
MIRT1033310	hsa-miR-3960	CLIP-seq
MIRT2238962	hsa-miR-4293	CLIP-seq
MIRT2238963	hsa-miR-4297	CLIP-seq
MIRT1033324	hsa-miR-4433	CLIP-seq
MIRT1033325	hsa-miR-4447	CLIP-seq
MIRT1033326	hsa-miR-4459	CLIP-seq
MIRT1033313	hsa-miR-4467	CLIP-seq
MIRT2238964	hsa-miR-4468	CLIP-seq
MIRT1033327	hsa-miR-4472	CLIP-seq
MIRT1033328	hsa-miR-4481	CLIP-seq
MIRT1033329	hsa-miR-4488	CLIP-seq
MIRT2238965	hsa-miR-4493	CLIP-seq
MIRT1033330	hsa-miR-4515	CLIP-seq
MIRT2238966	hsa-miR-455-3p	CLIP-seq
MIRT1033316	hsa-miR-4649-3p	CLIP-seq
MIRT2238967	hsa-miR-4656	CLIP-seq
MIRT2238968	hsa-miR-4675	CLIP-seq
MIRT2238969	hsa-miR-4676-5p	CLIP-seq
MIRT2238970	hsa-miR-4687-3p	CLIP-seq
MIRT2238971	hsa-miR-4689	CLIP-seq
MIRT1033331	hsa-miR-4697-5p	CLIP-seq
MIRT1033332	hsa-miR-4740-5p	CLIP-seq
MIRT2238972	hsa-miR-4741	CLIP-seq
MIRT1033333	hsa-miR-4745-5p	CLIP-seq
MIRT2238973	hsa-miR-4755-5p	CLIP-seq
MIRT2238974	hsa-miR-4757-5p	CLIP-seq
MIRT1033334	hsa-miR-4768-3p	CLIP-seq
MIRT2238975	hsa-miR-4780	CLIP-seq
MIRT2238976	hsa-miR-4784	CLIP-seq
MIRT2238977	hsa-miR-491-5p	CLIP-seq
MIRT2238978	hsa-miR-520d-5p	CLIP-seq
MIRT2238979	hsa-miR-520g	CLIP-seq
MIRT2238980	hsa-miR-520h	CLIP-seq
MIRT2238981	hsa-miR-524-5p	CLIP-seq
MIRT2238982	hsa-miR-575	CLIP-seq
MIRT2238983	hsa-miR-595	CLIP-seq
MIRT2238984	hsa-miR-623	CLIP-seq
MIRT2238985	hsa-miR-668	CLIP-seq
MIRT1033299	hsa-miR-1193	CLIP-seq
MIRT1033301	hsa-miR-1293	CLIP-seq
MIRT1033304	hsa-miR-3180	CLIP-seq
MIRT1033305	hsa-miR-3180-3p	CLIP-seq
MIRT1033306	hsa-miR-3184	CLIP-seq
MIRT1033307	hsa-miR-3196	CLIP-seq
MIRT1033310	hsa-miR-3960	CLIP-seq
MIRT1033311	hsa-miR-423-5p	CLIP-seq
MIRT1033313	hsa-miR-4467	CLIP-seq
MIRT1033314	hsa-miR-4483	CLIP-seq
MIRT2238945	hsa-miR-1224-5p	CLIP-seq
MIRT2542908	hsa-miR-1245b-5p	CLIP-seq
MIRT2238951	hsa-miR-204	CLIP-seq
MIRT2238952	hsa-miR-211	CLIP-seq
MIRT2542909	hsa-miR-3142	CLIP-seq
MIRT2238954	hsa-miR-3150b-3p	CLIP-seq
MIRT2238959	hsa-miR-3915	CLIP-seq
MIRT2542910	hsa-miR-3922-5p	CLIP-seq
MIRT2238963	hsa-miR-4297	CLIP-seq
MIRT2238971	hsa-miR-4689	CLIP-seq
MIRT2238973	hsa-miR-4755-5p	CLIP-seq
MIRT2238975	hsa-miR-4780	CLIP-seq
MIRT2238976	hsa-miR-4784	CLIP-seq
MIRT2238984	hsa-miR-623	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	8940081, 9079677, 9516479, 10377264, 10664463, 12061724, 12223469, 12852788, 12975581, 15806159, 16273093, 20665473, 24189400, 24728074, 25416956, 25814554, 31515488
GO:0005829	Component	Cytosol	IDA	10893408, 12021278
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IDA	10893408, 12021278
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	TAS	9710451
GO:0007411	Process	Axon guidance	TAS
GO:0008286	Process	Insulin receptor signaling pathway	IBA	21873635
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0017148	Process	Negative regulation of translation	ISS
GO:0019901	Function	Protein kinase binding	IDA	12021278
GO:0030335	Process	Positive regulation of cell migration	IDA	10893408, 12021278
GO:0034063	Process	Stress granule assembly	ISS
GO:0035091	Function	Phosphatidylinositol binding	IDA	12021278
GO:0038128	Process	ERBB2 signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IPI	15841400
GO:0042995	Component	Cell projection	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IBA	21873635
GO:0050900	Process	Leukocyte migration	TAS

MIM	HGNC	e!Ensembl
601522	4567	ENSG00000141738

Protein

UniProt ID

Q14451

Protein name

Growth factor receptor-bound protein 7 (B47) (Epidermal growth factor receptor GRB-7) (GRB7 adapter protein)

Protein function

Adapter protein that interacts with the cytoplasmic domain of numerous receptor kinases and modulates down-stream signaling. Promotes activation of down-stream protein kinases, including STAT3, AKT1, MAPK1 and/or MAPK3. Promotes activation of HR

PDB

1MW4 , 1WGR , 2L4K , 2QMS , 3PQZ , 4WWQ , 4X6S , 5D0J , 5EEL , 5EEQ , 5TYI , 5U06 , 5U1Q , 7MP3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00788	RA	100 → 186	Ras association (RalGDS/AF-6) domain	Domain
PF00169	PH	230 → 338	PH domain	Domain
PF08947	BPS	365 → 412	BPS (Between PH and SH2)	Domain
PF00017	SH2	431 → 512	SH2 domain	Domain

Sequence

MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERR
ATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAA
GATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFV
FRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRG
SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG
FCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLHPSCLG
SPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTS
LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHY
LILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL

Sequence length

532

Interactions

View interactions

	Reactome
			GRB7 events in ERBB2 signaling Signaling by SCF-KIT Downstream signal transduction Tie2 Signaling RET signaling

Show/Hide Causal Diseases (9)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	21552421
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	17426702, 19075277
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	19075277, 17426702
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	21552421
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	21552421
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	17426702, 19075277
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	23797736
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	23797736

Show/Hide Unknown Diseases (7)

Disease term	Disease name	References	Source
Unknown
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma	23797736	ClinVar
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS
Multiple Sclerosis	Multiple Sclerosis		GWAS
Myasthenia Gravis	Myasthenia Gravis		GWAS
Asthma	Asthma		GWAS
Ulcerative colitis	Ulcerative colitis		GWAS
Crohn Disease	Crohn Disease		GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma Pleomorphic	Associate	39384827
Arthritis Rheumatoid	Associate	16778393
Breast Neoplasms	Associate	10664463, 16475676, 18853468, 19717535, 21288332, 22253820, 23714731, 24194916, 26975656, 28295715, 31017268, 31627265, 33191115, 38036593
Breast Neoplasms	Stimulate	16849266
Breast Neoplasms Male	Associate	25906114
Carcinogenesis	Associate	18853468, 30696738
Carcinoma Hepatocellular	Associate	22253820
Carcinoma Ovarian Epithelial	Associate	37525498
Esophageal Neoplasms	Associate	22253820, 9710451
Esophageal Squamous Cell Carcinoma	Associate	26465158
Exfoliation Syndrome	Stimulate	8695558
GATA2 Deficiency	Associate	9409191
Inflammation	Inhibit	26484354
Melanoma	Associate	9740247
Neoplasm Invasiveness	Associate	9710451
Neoplasm Metastasis	Stimulate	18853468
Neoplasm Metastasis	Associate	34783299
Neoplasms	Associate	11809769, 18853468, 20665473, 22253820, 26617853, 26910888, 34893523, 38129809
Neoplasms	Inhibit	17229543, 19372580
Neoplasms	Stimulate	28295715
Ovarian Diseases	Associate	37525498
Ovarian Neoplasms	Associate	26617853, 34783299, 37522200, 37525498, 39809219
Salivary Duct Calculi	Associate	39384827
Stomach Neoplasms	Associate	11809769, 17229543, 38129809
Testicular Germ Cell Tumor	Associate	14670177, 16354586
Triple Negative Breast Neoplasms	Associate	21933890, 22140552
Uterine Cervicitis	Associate	30696738

GRB7 (growth factor receptor bound protein 7)