Gene Gene information from NCBI Gene database.
Entrez ID 2878
Gene name Glutathione peroxidase 3
Gene symbol GPX3
Synonyms (NCBI Gene)
GPx-PGSHPx-3GSHPx-P
Chromosome 5
Chromosome location 5q33.1
Summary The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy
miRNA miRNA information provided by mirtarbase database.
519
miRTarBase ID miRNA Experiments Reference
MIRT049503 hsa-miR-92a-3p CLASH 23622248
MIRT1032505 hsa-let-7a CLIP-seq
MIRT1032506 hsa-let-7b CLIP-seq
MIRT1032507 hsa-let-7c CLIP-seq
MIRT1032508 hsa-let-7d CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0004601 Function Peroxidase activity IEA
GO:0004602 Function Glutathione peroxidase activity IBA
GO:0004602 Function Glutathione peroxidase activity IDA 1897960, 3693360
GO:0004602 Function Glutathione peroxidase activity IEA
GO:0005515 Function Protein binding IPI 25416956
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
138321 4555 ENSG00000211445
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P22352
Protein name Glutathione peroxidase 3 (GPx-3) (GSHPx-3) (EC 1.11.1.9) (Extracellular glutathione peroxidase) (Plasma glutathione peroxidase) (GPx-P) (GSHPx-P)
Protein function Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.
PDB 2R37
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00255 GSHPx 40 153 Glutathione peroxidase Family
Tissue specificity TISSUE SPECIFICITY: Secreted in plasma.
Sequence
MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA
GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLK
NSCPPTSELLGTSDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
Sequence length 226
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases
  Detoxification of Reactive Oxygen Species