Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2878
Gene name Gene Name - the full gene name approved by the HGNC.
Glutathione peroxidase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPX3
Synonyms (NCBI Gene) Gene synonyms aliases
GPx-P, GSHPx-3, GSHPx-P
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q33.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049503 hsa-miR-92a-3p CLASH 23622248
MIRT1032505 hsa-let-7a CLIP-seq
MIRT1032506 hsa-let-7b CLIP-seq
MIRT1032507 hsa-let-7c CLIP-seq
MIRT1032508 hsa-let-7d CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004601 Function Peroxidase activity IEA
GO:0004602 Function Glutathione peroxidase activity IBA
GO:0004602 Function Glutathione peroxidase activity IDA 1897960, 3693360
GO:0004602 Function Glutathione peroxidase activity IEA
GO:0005515 Function Protein binding IPI 25416956
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
138321 4555 ENSG00000211445
Protein
UniProt ID P22352
Protein name Glutathione peroxidase 3 (GPx-3) (GSHPx-3) (EC 1.11.1.9) (Extracellular glutathione peroxidase) (Plasma glutathione peroxidase) (GPx-P) (GSHPx-P)
Protein function Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.
PDB 2R37
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00255 GSHPx 40 153 Glutathione peroxidase Family
Tissue specificity TISSUE SPECIFICITY: Secreted in plasma.
Sequence
MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA
GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLK
NSCPPTSELLGTSDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
Sequence length 226
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases
  Detoxification of Reactive Oxygen Species
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Inflammatory Bowel Disease Inflammatory bowel disease (MTAG) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 24167362, 30509602
Adenocarcinoma of Lung Associate 38204755, 40179422
Adenoma Associate 23778325, 30469315
Alveolitis Extrinsic Allergic Associate 37800807
Amyotrophic Lateral Sclerosis Associate 33541344, 37328865
Arthritis Juvenile Inhibit 39389271
Arthritis Psoriatic Inhibit 39389271
Arthritis Rheumatoid Associate 37087463
Ascites Associate 30509602
Asthma Associate 15038835, 35858526