Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2876
Gene name Gene Name - the full gene name approved by the HGNC.	Glutathione peroxidase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPX1
Synonyms (NCBI Gene) Gene synonyms aliases	GPXD, GSHPX1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Other studies

Show/Hide all(137)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040633	hsa-miR-92b-3p	CLASH	23622248
MIRT512631	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT512629	hsa-miR-4259	PAR-CLIP	20371350
MIRT512630	hsa-miR-4733-3p	PAR-CLIP	20371350
MIRT568884	hsa-miR-8060	PAR-CLIP	20371350
MIRT568883	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT512628	hsa-miR-4437	PAR-CLIP	20371350
MIRT512627	hsa-miR-3147	PAR-CLIP	20371350
MIRT512626	hsa-miR-4674	PAR-CLIP	20371350
MIRT512625	hsa-miR-1587	PAR-CLIP	20371350
MIRT512624	hsa-miR-3620-5p	PAR-CLIP	20371350
MIRT512631	hsa-miR-1911-3p	PAR-CLIP	23446348
MIRT512629	hsa-miR-4259	PAR-CLIP	23446348
MIRT512630	hsa-miR-4733-3p	PAR-CLIP	23446348
MIRT512628	hsa-miR-4437	PAR-CLIP	23446348
MIRT512627	hsa-miR-3147	PAR-CLIP	23446348
MIRT512626	hsa-miR-4674	PAR-CLIP	23446348
MIRT512625	hsa-miR-1587	PAR-CLIP	23446348
MIRT512624	hsa-miR-3620-5p	PAR-CLIP	23446348
MIRT486919	hsa-miR-634	PAR-CLIP	23592263
MIRT486918	hsa-miR-1226-3p	PAR-CLIP	23592263
MIRT486917	hsa-miR-4537	PAR-CLIP	23592263
MIRT486916	hsa-miR-505-5p	PAR-CLIP	23592263
MIRT486918	hsa-miR-1226-3p	PAR-CLIP	26701625
MIRT486917	hsa-miR-4537	PAR-CLIP	26701625
MIRT486916	hsa-miR-505-5p	PAR-CLIP	26701625
MIRT486919	hsa-miR-634	PAR-CLIP	26701625
MIRT512631	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT512629	hsa-miR-4259	PAR-CLIP	20371350
MIRT512630	hsa-miR-4733-3p	PAR-CLIP	20371350
MIRT568884	hsa-miR-8060	PAR-CLIP	20371350
MIRT568883	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT512628	hsa-miR-4437	PAR-CLIP	20371350
MIRT512627	hsa-miR-3147	PAR-CLIP	20371350
MIRT512626	hsa-miR-4674	PAR-CLIP	20371350
MIRT512625	hsa-miR-1587	PAR-CLIP	20371350
MIRT512624	hsa-miR-3620-5p	PAR-CLIP	20371350
MIRT512631	hsa-miR-1911-3p	PAR-CLIP	23446348
MIRT512629	hsa-miR-4259	PAR-CLIP	23446348
MIRT512630	hsa-miR-4733-3p	PAR-CLIP	23446348
MIRT512628	hsa-miR-4437	PAR-CLIP	23446348
MIRT512627	hsa-miR-3147	PAR-CLIP	23446348
MIRT512626	hsa-miR-4674	PAR-CLIP	23446348
MIRT512625	hsa-miR-1587	PAR-CLIP	23446348
MIRT512624	hsa-miR-3620-5p	PAR-CLIP	23446348
MIRT486919	hsa-miR-634	PAR-CLIP	23592263
MIRT486918	hsa-miR-1226-3p	PAR-CLIP	23592263
MIRT486917	hsa-miR-4537	PAR-CLIP	23592263
MIRT486916	hsa-miR-505-5p	PAR-CLIP	23592263
MIRT1032472	hsa-miR-125a-3p	CLIP-seq
MIRT1032473	hsa-miR-3156-5p	CLIP-seq
MIRT1032474	hsa-miR-3607-3p	CLIP-seq
MIRT1032475	hsa-miR-3686	CLIP-seq
MIRT1032476	hsa-miR-3934	CLIP-seq
MIRT1032477	hsa-miR-4326	CLIP-seq
MIRT1032478	hsa-miR-4464	CLIP-seq
MIRT1032479	hsa-miR-4469	CLIP-seq
MIRT1032480	hsa-miR-4652-3p	CLIP-seq
MIRT1032481	hsa-miR-4655-3p	CLIP-seq
MIRT1032482	hsa-miR-4691-5p	CLIP-seq
MIRT1032483	hsa-miR-4748	CLIP-seq
MIRT1032484	hsa-miR-516a-5p	CLIP-seq
MIRT1032485	hsa-miR-764	CLIP-seq
MIRT1032486	hsa-miR-1290	CLIP-seq
MIRT1032487	hsa-miR-3157-3p	CLIP-seq
MIRT1032488	hsa-miR-4290	CLIP-seq
MIRT1032489	hsa-miR-874	CLIP-seq
MIRT1032472	hsa-miR-125a-3p	CLIP-seq
MIRT2238711	hsa-miR-1303	CLIP-seq
MIRT2238712	hsa-miR-214	CLIP-seq
MIRT2238713	hsa-miR-3125	CLIP-seq
MIRT1032473	hsa-miR-3156-5p	CLIP-seq
MIRT1032474	hsa-miR-3607-3p	CLIP-seq
MIRT2238714	hsa-miR-3619-5p	CLIP-seq
MIRT1032475	hsa-miR-3686	CLIP-seq
MIRT2238715	hsa-miR-3916	CLIP-seq
MIRT1032476	hsa-miR-3934	CLIP-seq
MIRT2238716	hsa-miR-4261	CLIP-seq
MIRT2238717	hsa-miR-4291	CLIP-seq
MIRT2238718	hsa-miR-4496	CLIP-seq
MIRT1032480	hsa-miR-4652-3p	CLIP-seq
MIRT2238719	hsa-miR-4772-5p	CLIP-seq
MIRT1032484	hsa-miR-516a-5p	CLIP-seq
MIRT2238720	hsa-miR-646	CLIP-seq
MIRT2238721	hsa-miR-761	CLIP-seq
MIRT1032485	hsa-miR-764	CLIP-seq
MIRT2238722	hsa-miR-877	CLIP-seq
MIRT2238723	hsa-miR-922	CLIP-seq
MIRT2388689	hsa-miR-2110	CLIP-seq
MIRT2388690	hsa-miR-3128	CLIP-seq
MIRT2388691	hsa-miR-421	CLIP-seq
MIRT2388692	hsa-miR-4271	CLIP-seq
MIRT2388693	hsa-miR-4460	CLIP-seq
MIRT2388694	hsa-miR-4463	CLIP-seq
MIRT2388695	hsa-miR-450b-3p	CLIP-seq
MIRT2388696	hsa-miR-4527	CLIP-seq
MIRT2388697	hsa-miR-4709-5p	CLIP-seq
MIRT2388698	hsa-miR-4713-3p	CLIP-seq
MIRT2388699	hsa-miR-4720-5p	CLIP-seq
MIRT2388700	hsa-miR-4725-3p	CLIP-seq
MIRT2388701	hsa-miR-4727-3p	CLIP-seq
MIRT2388702	hsa-miR-4799-3p	CLIP-seq
MIRT2388703	hsa-miR-491-5p	CLIP-seq
MIRT2388704	hsa-miR-638	CLIP-seq
MIRT2388705	hsa-miR-769-3p	CLIP-seq
MIRT2388706	hsa-miR-941	CLIP-seq
MIRT2388689	hsa-miR-2110	CLIP-seq
MIRT2542641	hsa-miR-3184	CLIP-seq
MIRT2542642	hsa-miR-423-5p	CLIP-seq
MIRT2542643	hsa-miR-4266	CLIP-seq
MIRT2388692	hsa-miR-4271	CLIP-seq
MIRT2388693	hsa-miR-4460	CLIP-seq
MIRT2542644	hsa-miR-4480	CLIP-seq
MIRT2542645	hsa-miR-4695-5p	CLIP-seq
MIRT2388700	hsa-miR-4725-3p	CLIP-seq
MIRT2388701	hsa-miR-4727-3p	CLIP-seq
MIRT2542646	hsa-miR-4779	CLIP-seq
MIRT2388703	hsa-miR-491-5p	CLIP-seq
MIRT2388706	hsa-miR-941	CLIP-seq
MIRT2388689	hsa-miR-2110	CLIP-seq
MIRT2388690	hsa-miR-3128	CLIP-seq
MIRT2542641	hsa-miR-3184	CLIP-seq
MIRT2542642	hsa-miR-423-5p	CLIP-seq
MIRT2542643	hsa-miR-4266	CLIP-seq
MIRT2388692	hsa-miR-4271	CLIP-seq
MIRT2388693	hsa-miR-4460	CLIP-seq
MIRT2388694	hsa-miR-4463	CLIP-seq
MIRT2542644	hsa-miR-4480	CLIP-seq
MIRT2388696	hsa-miR-4527	CLIP-seq
MIRT2542645	hsa-miR-4695-5p	CLIP-seq
MIRT2388699	hsa-miR-4720-5p	CLIP-seq
MIRT2388700	hsa-miR-4725-3p	CLIP-seq
MIRT2388701	hsa-miR-4727-3p	CLIP-seq
MIRT2542646	hsa-miR-4779	CLIP-seq
MIRT2388702	hsa-miR-4799-3p	CLIP-seq
MIRT2388703	hsa-miR-491-5p	CLIP-seq
MIRT2388706	hsa-miR-941	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
TFAP2C	Activation	22964634

Show/Hide all(89)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IEA
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001885	Process	Endothelial cell development	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0004601	Function	Peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0004602	Function	Glutathione peroxidase activity	IDA	12829378, 12893824, 36608588
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32353859, 33060197, 35156780, 36012204, 36217030
GO:0005737	Component	Cytoplasm	IDA	10833429
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	10833429
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	12829378
GO:0006915	Process	Apoptotic process	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009609	Process	Response to symbiotic bacterium	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0009650	Process	UV protection	IMP	17097614
GO:0009725	Process	Response to hormone	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010269	Process	Response to selenium ion	IBA
GO:0010269	Process	Response to selenium ion	IEA
GO:0010269	Process	Response to selenium ion	IMP	12810669
GO:0010332	Process	Response to gamma radiation	IEA
GO:0014902	Process	Myotube differentiation	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0017124	Function	SH3 domain binding	IPI	12893824
GO:0019369	Process	Arachidonate metabolic process	IDA	11115402
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019372	Process	Lipoxygenase pathway	IDA	11115402
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033194	Process	Response to hydroperoxide	IEA
GO:0033197	Process	Response to vitamin E	IEA
GO:0033599	Process	Regulation of mammary gland epithelial cell proliferation	IMP	16945136
GO:0034599	Process	Cellular response to oxidative stress	IDA	12893824
GO:0034599	Process	Cellular response to oxidative stress	NAS	18853169
GO:0035094	Process	Response to nicotine	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IDA	16132718
GO:0042311	Process	Vasodilation	IEA
GO:0042542	Process	Response to hydrogen peroxide	IBA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042542	Process	Response to hydrogen peroxide	IMP	12829378
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	15203190
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0043403	Process	Skeletal muscle tissue regeneration	IEA
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045445	Process	Myoblast differentiation	IEA
GO:0045454	Process	Cell redox homeostasis	IDA	12829378
GO:0047066	Function	Phospholipid-hydroperoxide glutathione peroxidase activity	IDA	11115402, 36608588
GO:0047066	Function	Phospholipid-hydroperoxide glutathione peroxidase activity	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051593	Process	Response to folic acid	IEA
GO:0051702	Process	Biological process involved in interaction with symbiont	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060047	Process	Heart contraction	IEA
GO:0060047	Process	Heart contraction	IMP	14573732
GO:0060055	Process	Angiogenesis involved in wound healing	IEA
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IDA	12751788
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IMP	12221075
GO:0097413	Component	Lewy body	IDA	18853169
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	12221075
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1902905	Process	Positive regulation of supramolecular fiber organization	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IPI	12893824

MIM	HGNC	e!Ensembl
138320	4553	ENSG00000233276

Protein

UniProt ID

P07203

Protein name

Glutathione peroxidase 1 (GPx-1) (GSHPx-1) (EC 1.11.1.9) (Cellular glutathione peroxidase) (Phospholipid-hydroperoxide glutathione peroxidase GPX1) (EC 1.11.1.12)

Protein function

Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis (PubMed:11115402, PubMed:36608588). Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl

PDB

2F8A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00255	GSHPx	16 → 130	Glutathione peroxidase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in platelets (at protein level). {ECO:0000269|PubMed:11115402}.

Sequence

MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
ELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGA
GAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS
RRFQTIDIEPDIEALLSQGPSCA

Sequence length

203

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolic pathways Thyroid hormone synthesis Amyotrophic lateral sclerosis Huntington disease Pathways of neurodegeneration - multiple diseases		Synthesis of 12-eicosatetraenoic acid derivatives Synthesis of 15-eicosatetraenoic acid derivatives Detoxification of Reactive Oxygen Species Purine catabolism

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Gluthathione Peroxidase Deficiency	gluthathione peroxidase deficiency	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (119)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	40631607
Anemia Sickle Cell	Inhibit	19951064
Ataxia Telangiectasia	Associate	25882094
Atherosclerosis	Associate	21852236
Autism Spectrum Disorder	Associate	34997988
Autistic Disorder	Associate	34997988
Balkan Nephropathy	Associate	31382611
Barrett Esophagus	Associate	24852569
Blood Coagulation Disorders	Associate	35361071
Brain Neoplasms	Associate	33085656
Breast Neoplasms	Associate	12221075, 16945136, 20003265, 21045263, 22964634, 24039907, 26446998, 28587495, 29411539, 29543921, 35215475
Breast Neoplasms	Inhibit	18416831
Carcinoma Bronchogenic	Associate	16255782
Carcinoma Non Small Cell Lung	Associate	33474835
Carcinoma Ovarian Epithelial	Associate	28884887
Carcinoma Pancreatic Ductal	Associate	30538220
Carcinoma Renal Cell	Associate	31844035
Cardiovascular Diseases	Associate	27229152, 30394058, 36012132
Carotid Stenosis	Stimulate	29383971
Carotid Stenosis	Associate	29383971
Cholangitis Sclerosing	Associate	29180269
Chronic Periodontitis	Associate	21975116
Colitis Ulcerative	Stimulate	28052094
Colorectal Neoplasms	Associate	25206290, 36299603
Coronary Artery Disease	Associate	17825092, 19033020, 27229152, 30225256
Coronary Disease	Associate	27067415
Diabetes Gestational	Associate	33920886
Diabetes Mellitus	Associate	18541588, 30394058
Diabetes Mellitus Type 2	Associate	17825092, 27592002, 29383971
Diabetic Angiopathies	Associate	29383971
Disease	Associate	35205233
Drug Related Side Effects and Adverse Reactions	Associate	22016819
Endometrial Neoplasms	Associate	35205233, 39794059
Endometriosis	Associate	36013572
Epilepsy	Associate	39849427
Epilepsy Familial Mesial Temporal Lobe	Associate	19499324
Fibromyalgia	Associate	24817295
Friedreich Ataxia	Associate	22016819
Giant Cell Tumors	Associate	21224047
Glaucoma Open Angle	Inhibit	28547970
Glaucoma Open Angle	Associate	28547970
Glioblastoma	Associate	19505917, 28494176, 33085656, 36838582, 37572455, 38182643
Glioma	Associate	23259684, 33085656
Hallucinations	Associate	32710539
Hearing Loss	Associate	38147255
Hearing Loss Sensorineural	Associate	22877234
Hyperglycemia	Stimulate	23985558
Hypertension	Associate	21053180
Hypertriglyceridemia	Associate	18541588
Hypoxia	Inhibit	33174051
Hypoxia	Stimulate	37572455
Hypoxia Brain	Associate	37572455
Inflammation	Associate	21852236, 35361071, 36012132, 37390459
Inflammatory Bowel Diseases	Associate	28052094
Inflammatory Bowel Diseases	Inhibit	29180269, 33028732
Insulin Resistance	Associate	18541588, 30385096, 35806251
Kashin Beck Disease	Associate	20178852, 24058403
Keratoconus	Associate	31576926
Kidney Failure Chronic	Associate	31340563, 31382611
Kidney Neoplasms	Associate	31844035
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	25436036, 40565143
Leukemia Myeloid Acute	Associate	26823947, 34536536
Leukemia Myeloid Acute	Stimulate	32808668
Leukoplakia Oral	Associate	32378537
Lichen Planus Oral	Associate	32378537
Lung Neoplasms	Inhibit	18298806
Lung Neoplasms	Associate	18298806, 19887610, 23516596, 28464886
Lymphatic Metastasis	Stimulate	31844035
Lymphoma Large B Cell Diffuse	Associate	17179223
Malformations of Cortical Development Group I	Associate	33398366
Meningioma	Associate	19505917
Mental Disorders	Associate	33070477
Mental Disorders	Inhibit	40725019
Metabolic Diseases	Associate	26881045, 28783735
Metabolic Syndrome	Associate	18541588
Mitochondrial Diseases	Stimulate	19254950
Mitochondrial Diseases	Associate	23152058, 30385096
Moyamoya Disease	Associate	37400835
Nasopharyngeal Carcinoma	Inhibit	36447000
Neoplasm Metastasis	Stimulate	21224047, 31844035
Neoplasm Metastasis	Associate	31926619
Neoplasms	Associate	19347979, 19826042, 21224047, 25047527, 25670081, 26881045, 27077777, 28884887, 29543921, 30394058, 31032363, 31844035, 31863907, 33706760, 36676755
Neoplasms	Stimulate	21045263, 28464886
Neoplasms	Inhibit	30570876
Non alcoholic Fatty Liver Disease	Associate	26365964, 26897098
Noonan Syndrome 4	Associate	33070477
Obesity	Associate	18541588, 21208780, 26545512
Oral Submucous Fibrosis	Associate	32378537
Osteoarthritis	Associate	30286747
Osteoporosis	Associate	18924182, 36926781
Osteoporotic Fractures	Associate	36926781
Pancreatic Neoplasms	Associate	30538220
Pancreatitis	Associate	35062064
Parkinsonian Disorders	Associate	39273702
Pelvic Organ Prolapse	Associate	28783735
Periodontitis	Stimulate	21975116
Periodontitis	Inhibit	37390459
Peripheral Nervous System Diseases	Associate	27592002
Personality Disorders	Associate	36676755
Polycythemia Vera	Associate	30570876
Post Acute COVID 19 Syndrome	Associate	37373377
Precancerous Conditions	Associate	21586620
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	32808668
Primary Graft Dysfunction	Associate	25439478
Prostatic Neoplasms	Associate	23143801, 24437375, 24711484, 36295574
Pulmonary Disease Chronic Obstructive	Associate	29506519
Renal Insufficiency Chronic	Associate	31924810
Respiratory Distress Syndrome	Associate	31340563
Smoke Inhalation Injury	Associate	18298806
Squamous Cell Carcinoma of Head and Neck	Associate	28904321, 39815613
Stomach Diseases	Associate	30574618
Stomach Neoplasms	Associate	37862109
Thrombosis	Associate	35361071
Triple Negative Breast Neoplasms	Associate	31926619
Urethral Neoplasms	Associate	31382611
Urinary Bladder Neoplasms	Associate	36676755
Vascular Diseases	Associate	28673515
Vitreoretinopathy Proliferative	Associate	37107562
Weight Loss	Stimulate	30385096, 39427540

GPX1 (glutathione peroxidase 1)