TRAC (T cell receptor alpha constant)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
28755
Gene name Gene Name - the full gene name approved by the HGNC.
T cell receptor alpha constant
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRAC
Synonyms (NCBI Gene) Gene synonyms aliases
IMD7, TCRA, TRA, TRCA
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 29789755
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IDA 31461748
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
186880 12029 ENSG00000277734
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID P01848
Protein name T cell receptor alpha chain constant
Protein function Constant region of T cell receptor (TR) alpha chain (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-
PDB 1AO7 , 1BD2 , 1FYT , 1J8H , 1KGC , 1MI5 , 1OGA , 1QRN , 1QSF , 1YMM , 1ZGL , 2AK4 , 2BNQ , 2BNR , 2BNU , 2CDF , 2CDG , 2ESV , 2EYR , 2EYS , 2EYT , 2F53 , 2F54 , 2GJ6 , 2IAL , 2IAM , 2IAN , 2NX5 , 2P5E , 2P5W , 2PO6 , 2PYE , 2PYF , 2VLJ , 2VLK , 2VLM , 2VLR , 2XN9 , 2XNA , 3ARB , 3ARD , 3ARE , 3ARF , 3ARG , 3D39 , 3DX9 , 3DXA , 3FFC , 3GSN , 3HE7 , 3HG1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09291 DUF1968 6 → 90 Domain
Sequence 
IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNS
AVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFR
ILLLKVAGFNLLMTLRLWSS
Sequence length 140
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
T-Cell Receptor Alpha/Beta Deficiency tcr-alpha-beta-positive t-cell deficiency rs397514259 N/A
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anemia Sickle Cell Associate 30082871
Endometrial Neoplasms Associate 34763648
Glomerulonephritis IGA Associate 19470682
Neoplasms Associate 2788889
Seckel syndrome 1 Associate 40114033