Gene Gene information from NCBI Gene database.
Entrez ID 2873
Gene name G protein pathway suppressor 1
Gene symbol GPS1
Synonyms (NCBI Gene)
COPS1CSN1SGN1
Chromosome 17
Chromosome location 17q25.3
Summary This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. [pro
miRNA miRNA information provided by mirtarbase database.
162
miRTarBase ID miRNA Experiments Reference
MIRT024116 hsa-let-7i-5p Western blot 21530537
MIRT032090 hsa-let-7f-5p Western blot 21530537
MIRT032096 hsa-let-7e-3p Western blot 21530537
MIRT032191 hsa-let-7c-5p Western blot 21530537
MIRT048796 hsa-miR-93-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000338 Process Protein deneddylation IDA 19141280
GO:0005095 Function GTPase inhibitor activity TAS 8943324
GO:0005515 Function Protein binding IPI 17337451, 18850735, 19444310, 19615732, 20399188, 21145461, 24421388, 25043011, 27029275, 32296183, 33961781
GO:0005634 Component Nucleus IDA 24421388
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601934 4549 ENSG00000169727
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13098
Protein name COP9 signalosome complex subunit 1 (SGN1) (Signalosome subunit 1) (G protein pathway suppressor 1) (GPS-1) (JAB1-containing signalosome subunit 1) (Protein MFH)
Protein function Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of
PDB 4D10 , 4D18 , 4WSN , 6R6H , 6R7F , 6R7H , 6R7I , 6R7N , 8H38 , 8H3A , 8H3F
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10602 RPN7 127 309 26S proteasome subunit RPN7 Family
PF01399 PCI 324 428 PCI domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:8943324}.
Sequence
MPLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERL
QFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESG
VEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSN
ALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDS
QTQAILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALAT
FDRQELQRN
VISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAP
HVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSH
SKILYARD
VDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTP
ANSQSRMSTNM
Sequence length 491
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    DNA Damage Recognition in GG-NER
Formation of TC-NER Pre-Incision Complex
Cargo recognition for clathrin-mediated endocytosis
Neddylation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SCHIZOPHRENIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma Associate 32416156
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 38289496
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Associate 27325650
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Associate 37705202
★☆☆☆☆
Found in Text Mining only
Hepatitis B Associate 38289496
★☆☆☆☆
Found in Text Mining only
Moyamoya Disease Associate 23518061
★☆☆☆☆
Found in Text Mining only
Neoplasm Metastasis Associate 37705202
★☆☆☆☆
Found in Text Mining only
Neoplasms Inhibit 27325650
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 38289496
★☆☆☆☆
Found in Text Mining only
Penile Neoplasms Inhibit 27325650
★☆☆☆☆
Found in Text Mining only