TRIM42 (tripartite motif containing 42)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
287015
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 42
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM42
Synonyms (NCBI Gene) Gene synonyms aliases
PPP1R40, T4A1
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(32)
miRTarBase ID miRNA Experiments Reference
MIRT551759 hsa-miR-5580-3p HITS-CLIP 21572407
MIRT551758 hsa-miR-654-3p HITS-CLIP 21572407
MIRT551757 hsa-miR-511-3p HITS-CLIP 21572407
MIRT551756 hsa-miR-138-1-3p HITS-CLIP 21572407
MIRT551755 hsa-miR-3618 HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 25910212, 26871637, 31515488, 32296183, 32814053
GO:0008270 Function Zinc ion binding IEA
GO:0016567 Process Protein ubiquitination IEA
GO:0046872 Function Metal ion binding IEA
GO:0061630 Function Ubiquitin protein ligase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
620334 19014 ENSG00000155890
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8IWZ5
Protein name Tripartite motif-containing protein 42
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00643 zf-B_box 285 → 326 B-box zinc finger Domain
PF00041 fn3 606 → 691 Fibronectin type III domain Domain
Sequence 
METAMCVCCPCCTWQRCCPQLCSCLCCKFIFTSERNCTCFPCPYKDERNCQFCHCTCSES
PNCHWCCCSWANDPNCKCCCTASSNLNCYYYESRCCRNTIITFHKGRLRSIHTSSKTALR
TGSSDTQVDEVKSIPANSHLVNHLNCPMCSRLRLHSFMLPCNHSLCEKCLRQLQKHAEVT
ENFFILICPVCDRSHCMPYSNKMQLPENYLHGRLTKRYMQEHGYLKWRFDRSSGPILCQV
CRNKRIAYKRCITCRLNLCNDCLKAFHSDVAMQDHVFVDTSAEEQDEKICIHHPSSRIIE
YCRNDNKLLCTFCKFSFHNGHDTISLIDACSERAASLFSAIAKFKAVRYEIDNDLMEFNI
LKNSFKADKEAKRKEIRNGFLKLRSILQEKEKIIMEQIENLEVSRQKEIEKYVYVTTMKV
NEMDGLIAYSKEALKETGQVAFLQSAKILVDQIEDGIQTTYRPDPQLRLHSINYVPLDFV
ELSSAIHELFPTGPKKVRSSGDSLPSPYPVHSETMIARKVTFSTHSLGNQHIYQRSSSML
SFSNTDKKAKVGLEACGRAQSATPAKPTDGLYTYWSAGADSQSVQNSSSFHNWYSFNDGS
VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQMELCGQIRDIM
QQNLELHNLTPNTEYVFKVRAINDNGPGQWSDICKVVTPDGHGKNRAKWGLLKNIQSALQ
KHF
Sequence length 723
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Neoplasms Associate 23791107
Ovarian Neoplasms Associate 23791107