TRBC2 (T cell receptor beta constant 2)

Gene
Gene Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
28638
Gene name Gene Name - the full gene name approved by the HGNC.
T cell receptor beta constant 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRBC2
Synonyms (NCBI Gene) Gene synonyms aliases
TCRBC2
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q34
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 29789755
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IDA 31461748
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
615445 12157 ENSG00000211772
Protein
Gene Gene ontology Other IDs Protein
UniProt ID A0A5B9
Protein name T cell receptor beta constant 2
Protein function Constant region of T cell receptor (TR) beta chain (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-m
PDB 1AO7 , 1BD2 , 2EYR , 2EYS , 2EYT , 3KXF , 3O6F , 3O8X , 3O9W , 3QUX , 3T0E , 3TA3 , 3TVM , 4C56 , 4MVB , 4MXQ , 4N0C , 4N5E , 4NHU , 4ONH , 4P4K , 4UDT , 4UDU , 4WW1 , 4WW2 , 4WWK , 4Y16 , 4Y2D , 4Y4F , 4Y4H , 4Y4K , 4ZAK , 5BRZ , 5BS0 , 5C07 , 5C08 , 5C09 , 5C0A , 5C0B , 5C0C , 5EU6 , 5FK9 , 5FKA , 5HHM , 5HHO , 5HYJ , 5KS9 , 5KSA , 5KSB , 6CPH , 6CQL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07654 C1-set 10 → 102 Immunoglobulin C1-set domain Domain
Sequence 
DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQ
PLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIV
SAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG
Sequence length 178
Interactions View interactions
<