TRBC2 (T cell receptor beta constant 2)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 28638
Gene name T cell receptor beta constant 2
Gene symbol TRBC2
Synonyms (NCBI Gene)
TCRBC2
Chromosome 7
Chromosome location 7q34
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
Gene Gene ontology Other IDs Protein
Show/Hide all (11)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 29789755
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IDA 31461748
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
615445 12157 ENSG00000211772
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A5B9
Protein name T cell receptor beta constant 2
Protein function Constant region of T cell receptor (TR) beta chain (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-m
PDB 1AO7 , 1BD2 , 2EYR , 2EYS , 2EYT , 3KXF , 3O6F , 3O8X , 3O9W , 3QUX , 3T0E , 3TA3 , 3TVM , 4C56 , 4MVB , 4MXQ , 4N0C , 4N5E , 4NHU , 4ONH , 4P4K , 4UDT , 4UDU , 4WW1 , 4WW2 , 4WWK , 4Y16 , 4Y2D , 4Y4F , 4Y4H , 4Y4K , 4ZAK , 5BRZ , 5BS0 , 5C07 , 5C08 , 5C09 , 5C0A , 5C0B , 5C0C , 5EU6 , 5FK9 , 5FKA , 5HHM , 5HHO , 5HYJ , 5KS9 , 5KSA , 5KSB , 6CPH , 6CQL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07654 C1-set 10 → 102 Immunoglobulin C1-set domain Domain
Sequence 
DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQ
PLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIV
SAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG
Sequence length 178
Interactions View interactions