Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
286343
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich adaptor protein 1 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LURAP1L
Synonyms (NCBI Gene) Gene synonyms aliases
C9orf150, HYST0841, LRAP35b, bA3L8.2
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p23
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017481 hsa-miR-335-5p Microarray 18185580
MIRT556389 hsa-miR-381-3p PAR-CLIP 21572407
MIRT556388 hsa-miR-300 PAR-CLIP 21572407
MIRT556387 hsa-miR-424-5p PAR-CLIP 21572407
MIRT556386 hsa-miR-15b-5p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0043123 Process Positive regulation of canonical NF-kappaB signal transduction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616130 31452 ENSG00000153714
Protein
UniProt ID Q8IV03
Protein name Leucine rich adaptor protein 1-like
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14854 LURAP 80 196 Leucine rich adaptor protein Family
Sequence
MEDSPLPDLRDIELKLGRKVPESLVRSLRGEEPVPRERDRDPCGGSGGGGGGGGGGGGCS
SSSSYCSFPPSLSSSSSSSPTSGSPRGSHSSALERLETKLHLLRQEMVNLRATDVRLMRQ
LLVINESIESIKWMIEEKATITSRGSSLSGSLCSLLESQSTSLRGSYNSLHDGSDGLDGI
SVGSYLDTLADDVPGH
QTPSDLDQFSDSSLIEDSQALHKRPKLDSEYYCFG
Sequence length 231
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset) N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Dermatitis Atopic Associate 39245941