Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
286053
Gene name Gene Name - the full gene name approved by the HGNC.
NSE2 SUMO ligase component of SMC5/6 complex
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NSMCE2
Synonyms (NCBI Gene) Gene synonyms aliases
C8orf36, MMS21, NSE2, ZMIZ7
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a family of E3 small ubiquitin-related modifier (SUMO) ligases that mediates the attachment of a SUMO protein to proteins involved in nuclear transport, transcription, chromosome segregation and DNA repair. The encoded protei
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs757613817 T>- Pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
rs760514663 C>T Pathogenic Non coding transcript variant, coding sequence variant, stop gained
rs773917653 ->AGGG Pathogenic Frameshift variant, genic downstream transcript variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT677444 hsa-miR-552-3p HITS-CLIP 23824327
MIRT677443 hsa-miR-3159 HITS-CLIP 23824327
MIRT677442 hsa-miR-6504-3p HITS-CLIP 23824327
MIRT677441 hsa-miR-764 HITS-CLIP 23824327
MIRT677440 hsa-miR-4740-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000722 Process Telomere maintenance via recombination IMP 17589526
GO:0000724 Process Double-strand break repair via homologous recombination IBA 21873635
GO:0000724 Process Double-strand break repair via homologous recombination IMP 16810316
GO:0000781 Component Chromosome, telomeric region IDA 17589526
GO:0005515 Function Protein binding IPI 18086888, 25416956, 26496610, 32296183, 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617246 26513 ENSG00000156831
Protein
UniProt ID Q96MF7
Protein name E3 SUMO-protein ligase NSE2 (EC 2.3.2.-) (E3 SUMO-protein transferase NSE2) (MMS21 homolog) (hMMS21) (Non-structural maintenance of chromosomes element 2 homolog) (Non-SMC element 2 homolog)
Protein function E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in DNA double-strand break repair by homologous recombination (PubMed:16055714, PubMed:16810316). Is not be required for the stability of the complex (PubMed:16055714,
PDB 2YU4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11789 zf-Nse 156 216 Zinc-finger of the MIZ type in Nse subunit Domain
Sequence
MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYS
MDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADF
QNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPV
KNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCS
HTDIRKSDLIQDEALRRAIENHNK
KRHRHSE
Sequence length 247
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    SUMOylation of DNA damage response and repair proteins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Aortic aneurysm Aortic Aneurysm, Abdominal rs1555554098, rs267606902, rs121434526, rs121434527, rs121434528, rs387906592, rs387906781, rs387906782, rs397516685, rs397514037, rs112901682, rs397515325, rs397515330, rs794728025, rs112602953
View all (29 more)
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Diabetes mellitus Diabetes Mellitus rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
Hypertension Hypertensive disease rs13306026
Unknown
Disease term Disease name Evidence References Source
Acanthosis nigricans Acanthosis Nigricans ClinVar
Congestive heart failure Congestive heart failure ClinVar
Pancreatitis Acute pancreatitis ClinVar
Microcephalic Primordial Dwarfism-Insulin Resistance Syndrome microcephalic primordial dwarfism-insulin resistance syndrome GenCC
Associations from Text Mining
Disease Name Relationship Type References
Bantu siderosis Associate 30654714
Breast Neoplasms Associate 36224576
Calcinosis Cutis Associate 30654714
Cap Myopathy Associate 22234922
Colorectal Neoplasms Associate 19520795
Leukemia Associate 25245984
Leukemia Myeloid Acute Associate 25245984
Prostatic Neoplasms Associate 17978284, 22234922
Thyroid Neoplasms Associate 30654714
Urinary Bladder Neoplasms Associate 21051319