ZNF775 (zinc finger protein 775)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 285971
Gene name Zinc finger protein 775
Gene symbol ZNF775
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q36.1
miRNA miRNA information provided by mirtarbase database.
4
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (4)
miRTarBase ID miRNA Experiments Reference
MIRT1539218 hsa-miR-4286 CLIP-seq
MIRT1539219 hsa-miR-4701-5p CLIP-seq
MIRT1539220 hsa-miR-588 CLIP-seq
MIRT2162910 hsa-miR-4469 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96BV0
Protein name Zinc finger protein 775
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 107 → 129 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 135 → 157 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 163 → 185 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 191 → 213 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 281 → 303 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 309 → 331 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 337 → 359 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 367 → 388 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 446 → 468 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 474 → 496 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 502 → 524 Zinc finger, C2H2 type Domain
Sequence 
MESGLAGNGTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRP
RALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSGEGHFVCLDCGKRFSWWS
SLKIHQRTHTGEKPYLCGKCGKSFSQKPNLARHQRHHTGERPFCCPECARRFSQKQHLLK
HQKTHSRPATHSCPECERCFRHQVGLRIHQRAHARDRQGSRAGLHELIQDAAARRACRLQ
PGPPRGRPEWAWLGLCQGWWGQPGARAAVSGPEGPGEPRQFICNECGKSFTWWSSLNIHQ
RIHTGERPYACPECGRRFSQKPNLTRHLRNHTGERPHPCPHCGRGFRQKQHLLKHLRTHL
PGAQAAPCPSCGKSCRSRAALRAHQRAHAVAEPAVPAGEPGDQPQAEAIPGLAARPRSSQ
RSPGARDTLWGRGQAGLAGPGEPRQFICNECGKSFSWWSALTIHQRIHTGERPYPCPECG
RRFSQKPNLTRHRRNHTGERPYLCPACGRGFSQKQHLLKHQRVHRAAPACSPKEEAR
Sequence length 537
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Generic Transcription Pathway