Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	285671
Gene name	Ring finger protein 180
Gene symbol	RNF180
Synonyms (NCBI Gene)	RINES
Chromosome	5
Chromosome location	5q12.3

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments
MIRT1311479	hsa-miR-185	CLIP-seq
MIRT1311480	hsa-miR-3135	CLIP-seq
MIRT1311481	hsa-miR-3607-3p	CLIP-seq
MIRT1311482	hsa-miR-3686	CLIP-seq
MIRT1311483	hsa-miR-4280	CLIP-seq
MIRT1311484	hsa-miR-4306	CLIP-seq
MIRT1311485	hsa-miR-4328	CLIP-seq
MIRT1311486	hsa-miR-4477a	CLIP-seq
MIRT1311487	hsa-miR-4496	CLIP-seq
MIRT1311488	hsa-miR-4644	CLIP-seq
MIRT1311489	hsa-miR-4652-3p	CLIP-seq
MIRT1311490	hsa-miR-582-3p	CLIP-seq
MIRT1311491	hsa-miR-590-3p	CLIP-seq
MIRT1311492	hsa-miR-604	CLIP-seq
MIRT1311493	hsa-miR-647	CLIP-seq
MIRT1311494	hsa-miR-1299	CLIP-seq
MIRT1311495	hsa-miR-3148	CLIP-seq
MIRT1311496	hsa-miR-4698	CLIP-seq
MIRT1311497	hsa-miR-4782-5p	CLIP-seq
MIRT1311498	hsa-miR-516b	CLIP-seq
MIRT1311499	hsa-miR-522	CLIP-seq
MIRT1311500	hsa-miR-570	CLIP-seq
MIRT1311501	hsa-miR-875-3p	CLIP-seq
MIRT1311491	hsa-miR-590-3p	CLIP-seq
MIRT1311481	hsa-miR-3607-3p	CLIP-seq
MIRT1311482	hsa-miR-3686	CLIP-seq
MIRT1311486	hsa-miR-4477a	CLIP-seq
MIRT1311489	hsa-miR-4652-3p	CLIP-seq
MIRT1311491	hsa-miR-590-3p	CLIP-seq
MIRT1311494	hsa-miR-1299	CLIP-seq
MIRT1311495	hsa-miR-3148	CLIP-seq
MIRT1311497	hsa-miR-4782-5p	CLIP-seq
MIRT1311498	hsa-miR-516b	CLIP-seq
MIRT1311500	hsa-miR-570	CLIP-seq
MIRT1311501	hsa-miR-875-3p	CLIP-seq
MIRT2432829	hsa-miR-3144-3p	CLIP-seq
MIRT2432830	hsa-miR-4275	CLIP-seq
MIRT2432831	hsa-miR-4777-3p	CLIP-seq
MIRT2432832	hsa-miR-875-5p	CLIP-seq
MIRT2458425	hsa-miR-221	CLIP-seq
MIRT2458426	hsa-miR-222	CLIP-seq
MIRT2458427	hsa-miR-4318	CLIP-seq
MIRT2458428	hsa-miR-4693-5p	CLIP-seq
MIRT2458429	hsa-miR-548v	CLIP-seq
MIRT2458430	hsa-miR-892a	CLIP-seq
MIRT2458425	hsa-miR-221	CLIP-seq
MIRT2458426	hsa-miR-222	CLIP-seq
MIRT2612961	hsa-miR-3653	CLIP-seq
MIRT2612962	hsa-miR-3658	CLIP-seq
MIRT2458427	hsa-miR-4318	CLIP-seq
MIRT2458428	hsa-miR-4693-5p	CLIP-seq
MIRT2612963	hsa-miR-4742-3p	CLIP-seq
MIRT2458429	hsa-miR-548v	CLIP-seq
MIRT2612964	hsa-miR-579	CLIP-seq
MIRT2612965	hsa-miR-664	CLIP-seq
MIRT2458430	hsa-miR-892a	CLIP-seq
MIRT2612961	hsa-miR-3653	CLIP-seq
MIRT2612962	hsa-miR-3658	CLIP-seq
MIRT2612963	hsa-miR-4742-3p	CLIP-seq
MIRT2612964	hsa-miR-579	CLIP-seq
MIRT2612965	hsa-miR-664	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0005515	Function	Protein binding	IPI	36931259
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030534	Process	Adult behavior	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IBA
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0042415	Process	Norepinephrine metabolic process	IBA
GO:0042415	Process	Norepinephrine metabolic process	IEA
GO:0042428	Process	Serotonin metabolic process	IBA
GO:0042428	Process	Serotonin metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
616015	27752	ENSG00000164197

Q86T96

Protein name

E3 ubiquitin-protein ligase RNF180 (EC 2.3.2.27) (RING finger protein 180) (RING-type E3 ubiquitin transferase RNF180)

Protein function

E3 ubiquitin-protein ligase which promotes polyubiquitination and degradation by the proteasome pathway of ZIC2.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13920	zf-C3HC4_3	428 → 480		Domain

Sequence

MKRSKELITKNHSQEETSILRCWKCRKCIASSGCFMEYLENQVIKDKDDSVDAQNICHVW
HMNVEALPEWISCLIQKAQWTVGKLNCPFCGARLGGFNFVSTPKCSCGQLAAVHLSKSRT
DYQPTQAGRLMRPSVKYLSHPRVQSGCDKEALLTGGGSENRNHRLLNMARNNNDPGRLTE
ALCLEVRPTYFEMKNEKLLSKASEPKYQLFVPQLVTGRCATRAFHRKSHSLDLNISEKLT
LLPTLYEIHSKTTAYSRLNETQPIDLSGLPLQSSKNSYSFQNPSSFDPSMLLQRFSVAPH
ETQTQRGGEFQCGLEAASVYSDHTNTNNLTFLMDLPSAGRSMPEASDQEEHLSPLDFLHS
ANFSLGSINQRLNKRERSKLKNLRRKQRRRERWLQKQGKYSGVGLLDHMTLNNEMSTDED
NEYAEEKDSYICAVCLDVYFNPYMCYPCHHIFCEPCLRTLAKDNPSSTPCPLCRTIISRV
FFQTELNNATKTFFTKEYLKIKQSFQKSNSAKWPLPSCRKAFHLFGGFRRHAAPVTRRQF
PHGAHRMDYLHFEDDSRGWWFDMDMVIIYIYSVNWVIGFIVFCFLCYFFFPF

Sequence length

592

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE NEGATIVE BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinogenesis	Associate	21717426, 24833402	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Inhibit	35598017	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	39575407	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	22563461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	39575407	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Associate	27050149	★★★★★ ★☆☆☆☆ Found in Text Mining only
Helicobacter Infections	Associate	27050149	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Associate	21717426	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	37147733	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21717426, 35598017	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	24833402, 25769451, 27050149, 33082325, 36246966, 37147733	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Associate	27050149	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	21717426, 24833402, 25769451, 27050149, 36246966, 37147733	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Inhibit	33082325	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Ulcer	Associate	36246966	★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF180 (ring finger protein 180)